SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1j5xA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1j5xA
Domain Number 1 Region: 16-340
Classification Level Classification E-value
Superfamily SIS domain 8.06e-69
Family double-SIS domain 0.000000000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1j5xA   PDB: 1j5x   SUPERFAMILY: 1j5xA
Sequence length 342
Comment (A:)
Sequence
mgsdkihhhhhhmsktlkeitdqknelkkffenfvlnlekteifseiqknltdevlfvgc
gssynlaltisyyfervlkirtkaipagevafqkipdleerglaflfsrtgnttevllan
dvlkkrnhrtigitieeesrlakesdlplvfpvreeaivmtksfsmillslmfladkiag
nsterfselvgyspeffdiswkviekidlkehdhfvflgmseffgvslesalkciemslt
fseaystleyrhgpkalvkkgtlvfmqkvsgmdeqekrlrkeleslgatvlevgeggdip
vsndwksaflrtvpaqilgyqkaisrgispdkpphlektvvl
Download sequence
Identical sequences 1j5xA 1j5x_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]