SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1j6pA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1j6pA
Domain Number 1 Region: 63-340
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 2.42e-84
Family SAH/MTA deaminase-like 0.000000000104
Further Details:      
 
Domain Number 2 Region: 12-61,342-415
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 3.69e-31
Family SAH/MTA deaminase-like 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1j6pA   PDB: 1j6p
Sequence length 418
Comment (A:)
Sequence
mgsdkihhhhhhmiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvm
palfnththapmtllrgvaedlsfeewlfskvlpiedrltekmayygtilaqmemarhgi
agfvdmyfheewiakavrdfgmralltrglvdsngddggrleenlklynewngfegrifv
gfgphspylcseeylkrvfdtakslnapvtihlyetskeeydledilniglkevktiaah
cvhlperyfgvlkdipffvshnpasnlklgngiapvqrmiehgmkvtlgtdgaasnnsln
lffemrlasllqkaqnprnldvntclkmvtydgaqamgfksgkieegwnadlvvidldlp
emfpvqniknhlvhafsgevfatmvagkwiyfdgeyptidseevkrelariekelyss
Download sequence
Identical sequences 1j6p_A 1j6pA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]