SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1j78A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1j78A
Domain Number 1 Region: 9-191
Classification Level Classification E-value
Superfamily Serum albumin-like 2.46e-66
Family Serum albumin-like 0.0000000794
Further Details:      
 
Domain Number 2 Region: 202-380
Classification Level Classification E-value
Superfamily Serum albumin-like 4.61e-56
Family Serum albumin-like 0.0000000884
Further Details:      
 
Domain Number 3 Region: 388-448
Classification Level Classification E-value
Superfamily Serum albumin-like 5.86e-24
Family Serum albumin-like 0.0000642
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1j78A   PDB: 1j78
Sequence length 458
Comment (A:)
Sequence
lergrdyeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteacca
egadpdcydtrtsalsakscesnspfpvhpgtaecctkeglerklcmaalkhqpqefpty
veptndeiceafrkdpkeyanqfmweystnygqaplsllvsytksylsmvgscctsaspt
vcflkerlqlkhlsllttlsnrvcsqyaaygekksrlsnliklaqkvptadledvlplae
ditnilskccesasedcmakelpehtvklcdnlstknskfedccqektamdvfvctyfmp
aaqlpelpdvelptnkdvcdpgntkvmdkytfelsrrthlpevflskvleptlkslgecc
dvedsttcfnakgpllkkelssfidkgqelcadysentfteykkklaerlkaklpdatpt
elaklvnkrsdfasnccsinspplycdseidaelknil
Download sequence
Identical sequences 1j78A 1j78_A 1j78_B 1j7e_A 1j7e_B 1lot_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]