SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1j7bA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1j7bA
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.02e-51
Family 2Fe-2S ferredoxin-related 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1j7bA   PDB: 1j7b   SUPERFAMILY: 1j7bA
Sequence length 98
Comment (A:)
Sequence
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkkedly
Download sequence
Identical sequences 1j7b_A cath|current|1j7bA00/1-98 d1j7ba_ 1j7bA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]