SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jbiA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jbiA
Domain Number 1 Region: 3-98
Classification Level Classification E-value
Superfamily LCCL domain 5.49e-30
Family LCCL domain 0.00000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jbiA   PDB: 1jbi   SUPERFAMILY: 1jbiA
Sequence length 100
Comment (A:)
Sequence
tapiaitcftrgldirkekadvlcpggcpleefsvygnivyasvssicgaavhrgvisns
ggpvrvyslpgrenyssvdangiqsqmlsrwsasftvtle
Download sequence
Identical sequences 1jbi_A 000007456|e1jbiA1|255.1.1.1|A:1-100 cath|current|1jbiA00/1-100 d1jbia_ 1jbiA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]