SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jdqA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jdqA
Domain Number 1 Region: 2-96
Classification Level Classification E-value
Superfamily SirA-like 3.66e-29
Family SirA-like 0.00000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jdqA   PDB: 1jdq   SUPERFAMILY: 1jdqA
Sequence length 98
Comment (A:)
Sequence
gsshhhhhhssglvprgshmakyqvtktldvrgevcpvpdvetkralqnmkpgeilevwi
dypmskeripetvkklghevleieevgpsewkiyikvk
Download sequence
Identical sequences 1jdqA 000005635|e1jdqA1|328.5.1.1|A:1-98 cath|current|1jdqA00/1-98 1jdq_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]