SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1je3A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1je3A
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily SirA-like 1.32e-27
Family SirA-like 0.00000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1je3A   PDB: 1je3   SUPERFAMILY: 1je3A
Sequence length 97
Comment (A:)
Sequence
mgsshhhhhhssglvprgshmknivpdyrldmvgepcpypavatleampqlkkgeilevv
sdcpqsinnipldarnhgytvldiqqdgptiryliqk
Download sequence
Identical sequences 1je3A 1je3_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]