SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jeiA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jeiA
Domain Number 1 Region: 2-51
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000000395
Family LEM domain 0.0000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jeiA   PDB: 1jei   SUPERFAMILY: 1jeiA
Sequence length 53
Comment (A:)
Sequence
dnyadlsdtelttllrryniphgpvvgstrrlyekkifeyetqrrrlsppsss
Download sequence
Identical sequences 1jei_A cath|current|1jeiA00/1-53 d1jeia_ 1jeiA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]