SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jggA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jggA
Domain Number 1 Region: 2-57
Classification Level Classification E-value
Superfamily Homeodomain-like 2.99e-27
Family Homeodomain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jggA   PDB: 1jgg   SUPERFAMILY: 1jggA
Sequence length 60
Comment (A:)
Sequence
vrryrtaftrdqlgrlekefykenyvsrprrcelaaqlnlpestikvwfqnrrmkdkrqr
Download sequence
Identical sequences cath|current|1jggA00/103-159 cath|current|1jggB00/303-359 1jgg_A 1jgg_B 1jggA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]