SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jgtA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jgtA
Domain Number 1 Region: 217-472
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.34e-61
Family N-type ATP pyrophosphatases 0.000000000357
Further Details:      
 
Domain Number 2 Region: 10-208
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.41e-33
Family Class II glutamine amidotransferases 0.00000000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jgtA   PDB: 1jgt
Sequence length 513
Comment (A:)
Sequence
MGAPVLPAAFGFLASARTGGGRAPGPVFATRGSHTDIDTPQGERSLAATLVHAPSVAPDR
AVARSLTGAPTTAVLAGEIYNRDELLSVLPAGPAPEGDAELVLRLLERYDLHAFRLVNGR
FATVVRTGDRVLLATDHAGSVPLYTCVAPGEVRASTEAKALAAHRDPKGFPLADARRVAG
LTGVYQVPAGAVMDIDLGSGTAVTHRTWTPGLSRRILPEGEAVAAVRAALEKAVAQRVTP
GDTPLVVLSGGIDSSGVAACAHRAAGELDTVSMGTDTSNEFREARAVVDHLRTRHREITI
PTTELLAQLPYAVWASESVDPDIIEYLLPLTALYRALDGPERRILTGYGADIPLGGMHRE
DRLPALDTVLAHDMATFDGLNEMSPVLSTLAGHWTTHPYWDREVLDLLVSLEAGLKRRHG
RDKWVLRAAMADALPAETVNRPKLGVHEGSGTTSSFSRLLLDHGVAEDRVHEAKRQVVRE
LFDLTVGGGRHPSEVDTDDVVRSVADRTARGAA
Download sequence
Identical sequences B5GLC7 P0DJQ7 P0DJQ8
1jgtA 1jgt_A 1jgt_B 1m1z_A 1m1z_B 1mb9_A 1mb9_B 1mbz_A 1mbz_B 1mc1_A 1mc1_B WP_003952510.1.11688 WP_003952510.1.2818 WP_003952510.1.6963 WP_003952510.1.96813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]