SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jj2M from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jj2M
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Translational machinery components 4.04e-58
Family Ribosomal protein L18 and S11 0.00000000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jj2M   PDB: 1jj2   SUPERFAMILY: 1jj2M
Sequence length 186
Comment (M:)
Sequence
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel
Download sequence
Identical sequences 000011123|e1vqoN1|2484.1.1.47|N:2-187 000114632|e1m1kO1|2484.1.1.47|O:1-186 000114633|e2otjN1|2484.1.1.47|N:2-187 000114634|e1k8aO1|2484.1.1.47|O:1-186 000114635|e1yjwN1|2484.1.1.47|N:2-187 000114636|e1m90O1|2484.1.1.47|O:1-186 000114637|e1jj2M1|2484.1.1.47|M:1-186 000114638|e1s72N1|2484.1.1.47|N:2-187 000114639|e1vq6N1|2484.1.1.47|N:2-187 000114640|e1ffkK1|2484.1.1.47|K:1-186 000114641|e1q86O1|2484.1.1.47|O:1-186 000114642|e1q81O1|2484.1.1.47|O:1-186 000114643|e1vqnN1|2484.1.1.47|N:2-187 000114644|e1yitN1|2484.1.1.47|N:2-187 000114645|e1vq5N1|2484.1.1.47|N:2-187 000114646|e1q7yO1|2484.1.1.47|O:1-186 000114647|e1vqmN1|2484.1.1.47|N:2-187 000114648|e1yhqN1|2484.1.1.47|N:2-187 000114649|e1vqpN1|2484.1.1.47|N:2-187 000114650|e1kqsM1|2484.1.1.47|M:1-186 000114651|e1k9mO1|2484.1.1.47|O:1-186 000114652|e1vqlN1|2484.1.1.47|N:2-187 000114653|e1vq8N1|2484.1.1.47|N:2-187 000114654|e1k73O1|2484.1.1.47|O:1-186 000114655|e1yijN1|2484.1.1.47|N:2-187 000114656|e1qvfM1|2484.1.1.47|M:1-186 000114657|e1vq4N1|2484.1.1.47|N:2-187 000114658|e1njiO1|2484.1.1.47|O:1-186 000114659|e1kd1O1|2484.1.1.47|O:1-186 000114660|e1yi2N1|2484.1.1.47|N:2-187 000114661|e1kc8O1|2484.1.1.47|O:1-186 000114662|e1vqkN1|2484.1.1.47|N:2-187 000114663|e1vq9N1|2484.1.1.47|N:2-187 000114664|e1yj9N1|2484.1.1.47|N:2-187 000114665|e1yjnN1|2484.1.1.47|N:2-187 000114666|e1n8rO1|2484.1.1.47|O:1-186 000114667|e1vq7N1|2484.1.1.47|N:2-187 000114668|e2otlN1|2484.1.1.47|N:2-187 000114669|e1qvgM1|2484.1.1.47|M:1-186 000114670|e1q82O1|2484.1.1.47|O:1-186 000138386|e3i55N1|2484.1.1.47|N:2-187 000150739|e3ow2M1|2484.1.1.47|M:1-186 000270751|e1w2bM1|2484.1.1.47|M:1-186 000339058|e2qa4N1|2484.1.1.47|N:2-187 000341941|e3cc2N1|2484.1.1.47|N:2-187 000341973|e3cc4N1|2484.1.1.47|N:2-187 000342005|e3cc7N1|2484.1.1.47|N:2-187 000342037|e3cceN1|2484.1.1.47|N:2-187 000342069|e3ccjN1|2484.1.1.47|N:2-187 000342101|e3cclN1|2484.1.1.47|N:2-187 000342133|e3ccmN1|2484.1.1.47|N:2-187 000342165|e3ccqN1|2484.1.1.47|N:2-187 000342197|e3ccrN1|2484.1.1.47|N:2-187 000342229|e3ccsN1|2484.1.1.47|N:2-187 000342261|e3ccuN1|2484.1.1.47|N:2-187 000342293|e3ccvN1|2484.1.1.47|N:2-187 000342325|e3cd6N1|2484.1.1.47|N:2-187 000345378|e3cpwM1|2484.1.1.47|M:2-187 000348522|e3cmaN1|2484.1.1.47|N:2-187 000348554|e3cmeN1|2484.1.1.47|N:2-187 000349247|e2qexN1|2484.1.1.47|N:2-187 000361653|e3cxcM1|2484.1.1.47|M:1-186 000361839|e3g4sN1|2484.1.1.47|N:1-186 000361888|e3g6eN1|2484.1.1.47|N:1-186 000361920|e3g71N1|2484.1.1.47|N:1-186 000386136|e3i56N1|2484.1.1.47|N:2-187 001007467|e4hubN1|2484.1.1.47|N:2-187 001445383|e4v9fN1|2484.1.1.47|N:2-187 cath|current|1jj2M00/1-186 cath|current|1k73O00/1-186 cath|current|1k8aO00/1-186 cath|current|1k9mO00/1-186 cath|current|1kc8O00/1-186 cath|current|1kd1O00/1-186 cath|current|1kqsM00/1-186 cath|current|1m1kO00/1-186 cath|current|1m90O00/1-186 cath|current|1n8rO00/1-186 cath|current|1njiO00/1-186 cath|current|1q7yO00/1-186 cath|current|1q81O00/1-186 cath|current|1q82O00/1-186 cath|current|1q86O00/1-186 cath|current|1qvfM00/1-186 cath|current|1qvgM00/1-186 cath|current|1w2bM00/1-186 cath|current|3cxcM00/1-186 cath|current|3g4sN00/1-186 cath|current|3g6eN00/1-186 cath|current|3g71N00/1-186 cath|current|3ow2M00/1-186 d1ffkk_ d1jj2m_ d1k73o_ d1k8ao_ d1k9mo_ d1kc8o_ d1kd1o_ d1kqsm_ d1m1ko_ d1m90o_ d1n8ro_ d1njio_ d1q7yo_ d1q81o_ d1q82o_ d1q86o_ d1qvfm_ d1qvgm_ d1s72n_ d1vq4n1 d1vq5n1 d1vq6n1 d1vq7n1 d1vq8n1 d1vq9n1 d1vqkn1 d1vqln1 d1vqmn1 d1vqnn1 d1vqon1 d1vqpn1 d1yhqn1 d1yi2n1 d1yijn1 d1yitn1 d1yj9n1 d1yjnn1 d1yjwn1 d2otjn1 d2otln1 1jj2M 1ffk_K 1jj2_M 1k73_O 1k8a_O 1k9m_O 1kc8_O 1kd1_O 1kqs_M 1m1k_O 1m90_O 1ml5_q 1n8r_O 1nji_O 1q7y_O 1q81_O 1q82_O 1q86_O 1qvf_M 1qvg_M 1w2b_M 3cxc_M 3g4s_N 3g6e_N 3g71_N 3ow2_M 4v42_BQ 4v4p_AQ 4v4r_BS 4v4s_BS 4v4t_BS

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]