SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jjcA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jjcA
Domain Number 1 Region: 86-346
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.35e-130
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000002
Further Details:      
 
Domain Number 2 Region: 3-84
Classification Level Classification E-value
Superfamily tRNA-binding arm 3.11e-28
Family Phenylalanyl-tRNA synthetase (PheRS) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jjcA   PDB: 1jjc   SUPERFAMILY: 1jjcA
Sequence length 350
Comment (A:)
Sequence
MLEEALAAIQNARDLEELKALKARYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAA
LEAALEAREKALEEAALKEALERERVDVSLPGASLFSGGLHPITLMERELVEIFRALGYQ
AVEGPEVESEFFNFDALNIPEHHPARDMWDTFWLTGEGFRLEGPLGEEVEGRLLLRTHTS
PMQVRYMVAHTPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIAMAHLKGAIYEL
AQALFGPDSKVRFQPVYFPFVEPGAQFAVWWPEGGKWLELGGAGMVHPKVFQAVDAYRER
LGLPPAYRGVTGFAFGLGVERLAMLRYGIPDIRYFFGGRLKFLEQFKGVL
Download sequence
Identical sequences P27001 Q5SGX2
gi|55981927|ref|YP_145224.1| 1jjcA 300852.TTHA1958 YP_145224.1.19876 cath|current|1eiyA00/6-350 cath|current|2iy5A00/15-350 1b70_A 1b7y_A 1eiy_A 1jjc_A 1pys_A 2iy5_A 3hfz_A 3teh_A 4tva_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]