SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jjcB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jjcB
Domain Number 1 Region: 197-395
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.39e-67
Family B3/B4 domain of PheRS, PheT 0.00000000358
Further Details:      
 
Domain Number 2 Region: 465-675
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.97e-51
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000119
Further Details:      
 
Domain Number 3 Region: 683-774
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.02e-26
Family Anticodon-binding domain of PheRS 0.00000232
Further Details:      
 
Domain Number 4 Region: 41-148
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.13e-21
Family Myf domain 0.00000162
Further Details:      
 
Domain Number 5 Region: 403-473
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.83e-18
Family Domains B1 and B5 of PheRS-beta, PheT 0.0000106
Further Details:      
 
Domain Number 6 Region: 1-38,151-180
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000395
Family Domains B1 and B5 of PheRS-beta, PheT 0.0000873
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jjcB   PDB: 1jjc
Sequence length 785
Comment (B:)
Sequence
MRVPFSWLKAYVPELESPEVLEERLAGLGFETDRIERVFPIPRGVVFARVLEAHPIPGTR
LKRLVLDAGRTVEVVSGAENARKGIGVALALPGTELPGLGQKVGERVIQGVRSFGMALSP
RELGVGEYGGGLLEFPEDALPPGTPLSEAWPEEVVLDLEVTPNRPDALGLLGLARDLHAL
GYALVEPEAALKAEALPLPFALKVEDPEGAPHFTLGYAFGLRVAPSPLWMQRALFAAGMR
PINNVVDVTNYVMLERAQPMHAFDLRFVGEGIAVRRAREGERLKTLDGVERTLHPEDLVI
AGWRGEESFPLGLAGVMGGAESEVREDTEAIALEVACFDPVSIRKTARRHGLRTEASHRF
ERGVDPLGQVPAQRRALSLLQALAGARVAEALLEAGSPKPPEAIPFRPEYANRLLGTSYP
EAEQIAILKRLGCRVEGEGPTYRVTPPSHRLDLRLEEDLVEEVARIQGYETIPLALPAFF
PAPDNRGVEAPYRKEQRLREVLSGLGFQEVYTYSFMDPEDARRFRLDPPRLLLLNPLAPE
KAALRTHLFPGLVRVLKENLDLDRPERALLFEVGRVFREREETHLAGLLFGEGVGLPWAK
ERLSGYFLLKGYLEALFARLGLAFRVEAQAFPFLHPGVSGRVLVEGEEVGFLGALHPEIA
QELELPPVHLFELRLPLPDKPLAFQDPSRHPAAFRDLAVVVPAPTPYGEVEALVREAAGP
YLESLALFDLYQGPPLPEGHKSLAFHLRFRHPKRTLRDEEVEEAVSRVAEALRARGFGLR
GLDTP
Download sequence
Identical sequences P27002 Q5SGX1
1jjcB 1b70_B 1b7y_B 1eiy_B 1jjc_B 1pys_B 2akw_B 2aly_B 2amc_B 3hfz_B 3teh_B 4tva_B gi|55981928|ref|YP_145225.1| YP_145225.1.19876 300852.TTHA1959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]