SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jk4A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jk4A
Domain Number 1 Region: 2-81
Classification Level Classification E-value
Superfamily Neurophysin II 1.32e-35
Family Neurophysin II 0.00000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jk4A   PDB: 1jk4   SUPERFAMILY: 1jk4A
Sequence length 89
Comment (A:)
Sequence
lrqclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkpcgsggr
caaagiccndescvtepecregvgfprrv
Download sequence
Identical sequences cath|current|1jk4A00/7-85 cath|current|1jk6A00/7-86 cath|current|1jk6C00/7-86 1jk4_A 1jk6_A 1jk6_C 1jk4A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]