SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jkgB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jkgB
Domain Number 1 Region: 2-185
Classification Level Classification E-value
Superfamily NTF2-like 3.09e-66
Family NTF2-like 0.0000000171
Further Details:      
 
Domain Number 2 Region: 182-250
Classification Level Classification E-value
Superfamily UBA-like 1.58e-26
Family TAP-C domain-like 0.0000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jkgB   PDB: 1jkg   SUPERFAMILY: 1jkgB
Sequence length 250
Comment (B:)
Sequence
appckgsyfgtenlkslvlhflqqyyaiydsgdrqglldayhdgaccslsipfipqnpar
sslaeyfkdsrnvkklkdptlrfrllkhtrlnvvaflnelpktqhdvnsfvvdisaqtst
llcfsvngvfkevdgksrdslraftrtfiavpasnsglcivndelfvrnasseeiqrafa
mpaptpssspvptlspeqqemlqafstqsgmnlewsqkclqdnnwdytrsaqafthlkak
geipevafmk
Download sequence
Identical sequences 1jkgB 1jkg_B 1jn5_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]