SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jmvA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jmvA
Domain Number 1 Region: 1-138
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 9.28e-34
Family Universal stress protein-like 0.000000604
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jmvA   PDB: 1jmv   SUPERFAMILY: 1jmvA
Sequence length 141
Comment (A:)
Sequence
MYKHILVAVDLSEESPILLKKAVGIAKRHDAKLSIIHVDVNFSDLYTGLIDVNMSSMQDR
ISTETQKALLDLAESVDYPISEKLSGSGDLGQVLSDAIEQYDVDLLVTGHHQDFWSKLMS
STRQVMNTIKIDMLVVPLRDE
Download sequence
Identical sequences A0A0E1SXF3 A0A2J1DQN5 A4MWQ4 P44880
gi|386266457|ref|YP_005829949.1| NP_438975.1.63031 WP_005648375.1.12713 WP_005648375.1.20018 WP_005648375.1.3733 WP_005648375.1.40040 WP_005648375.1.40503 WP_005648375.1.61635 WP_005648375.1.68713 WP_005648375.1.76422 WP_005648375.1.78014 WP_005648375.1.86544 WP_005648375.1.9694 WP_005648375.1.98200 71421.HI0815 gi|16272756|ref|NP_438975.1| cath|current|1jmvA00/1-140 cath|current|1jmvB00/1-139 cath|current|1jmvC00/1-138 cath|current|1jmvD00/1-137 gi|386264745|ref|YP_005828238.1| 1jmvA 1jmv_A 1jmv_B 1jmv_C 1jmv_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]