SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jqrA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jqrA
Domain Number 1 Region: 1-173
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.61e-51
Family DNA polymerase beta-like 0.0000000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jqrA   PDB: 1jqr   SUPERFAMILY: 1jqrA
Sequence length 174
Comment (A:)
Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKK
LLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPV
SYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Download sequence
Identical sequences A0A0A1E3N6 A9JL63 A9JLZ4 D4I5T4 P42494
1jaj_A 1jqr_A 2m2t_A 2m2u_A 2m2v_A 2m2w_A 000006820|e1jqrA1|316.1.1.7|A:1-174 000078162|e1jajA1|316.1.1.7|A:1-174 001284342|e2m2tA1|316.1.1.7|A:1-174 001284343|e2m2uA1|316.1.1.7|A:1-174 001284344|e2m2vA1|316.1.1.7|A:1-174 001284345|e2m2wA1|316.1.1.7|A:1-174 d1jaja_ d1jqra_ d2m2ta_ d2m2ua_ d2m2va_ d2m2wa_ A9JL63_ASFPB A9JLZ4_ASFPP D4I5T4_ASF DPOLX_ASFB7 gi|9628204|ref|NP_042790.1| 1jqrA NP_042790.1.62832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]