SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jt6A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jt6A
Domain Number 1 Region: 73-186
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 8.15e-38
Family Tetracyclin repressor-like, C-terminal domain 0.000000678
Further Details:      
 
Domain Number 2 Region: 3-65
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000126
Family Tetracyclin repressor-like, N-terminal domain 0.0000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jt6A   PDB: 1jt6
Sequence length 188
Comment (A:)
Sequence
mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
iflnglsk
Download sequence
Identical sequences 1jt6_A 1jt6_B 1jt6_D 1jt6_E 1rpw_A 1rpw_B 1rpw_C 1rpw_D 2g0e_A 2g0e_B 2g0e_D 2g0e_E 1jt6A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]