SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jwwA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jwwA
Domain Number 1 Region: 4-66
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 1.76e-31
Family HMA, heavy metal-associated domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jwwA   PDB: 1jww   SUPERFAMILY: 1jwwA
Sequence length 80
Comment (A:)
Sequence
vtekaefdiegmtcaacanriekrlnkiegvanapvnfaletvtveynpkeasvsdlkea
vdklgyklklkgeqdsiegr
Download sequence
Identical sequences 1jww_A 2voy_A 1jwwA 000135026|e2voyA1|304.3.1.7|A:1-80 cath|current|1jwwA00/1-80 cath|current|1p6tA02/72-151 d1jwwa_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]