SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1k0tA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1k0tA
Domain Number 1 Region: 6-65
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 9.18e-16
Family 7-Fe ferredoxin 0.0000704
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1k0tA   PDB: 1k0t   SUPERFAMILY: 1k0tA
Sequence length 80
Comment (A:)
Sequence
shsvkiydtcigctqcvracpldvlemvpwdgckagqiassprtedcvgckrcetacptd
flsirvylgaettrsmglay
Download sequence
Identical sequences 000067010|e1k0tA1|205.1.1.6|A:1-80 cath|current|1k0tA00/1-80 d1k0ta_ 1k0t_A 1k0tA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]