SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1k1dA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1k1dA
Domain Number 1 Region: 50-395
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 1.36e-146
Family Hydantoinase (dihydropyrimidinase), catalytic domain 0.0000000000076
Further Details:      
 
Domain Number 2 Region: 2-52,383-455
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 1.65e-37
Family Hydantoinase (dihydropyrimidinase) 0.0000364
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1k1dA   PDB: 1k1d
Sequence length 460
Comment (A:)
Sequence
mtkiikngtivtatdtyeahllikdgkiamigqnleekgaevidakgcyvfpggidphth
ldmplggtvtkddfesgtiaaafggtttiidfcltnkgeplkkaietwhnkangkavidy
gfhlmiseitddvleelpkvleeegitslkvfmayknvfqaddgtlyctllaakelgalv
mvhaengdvidyltkkaladgntdpiyhaltrppelegeatgracqltelagsqlyvvhv
tcaqavekiaearnkgldvwgetcpqylvldqsylekpnfegakyvwspplrekwhqevl
wnalkngqlqtlgsdqcsfdfkgqkelgrgdftkipnggpiiedrvsilfsegvkkgrit
lnqfvdivstriaklfglfpkkgtivvgsdadlvifdpniervisaethhmavdynafeg
mkvtgepvsvlcrgefvvrdkqfvgkpgygqylkrakygt
Download sequence
Identical sequences 1k1d_A 1k1d_B 1k1d_C 1k1d_D 1k1d_E 1k1d_F 1k1d_G 1k1d_H 1k1dA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]