SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1k2xA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1k2xA
Domain Number 1 Region: 3-165
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.31e-47
Family (Glycosyl)asparaginase 0.0000000545
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1k2xA   PDB: 1k2x
Sequence length 177
Comment (A:)
Sequence
gkaviaihggagaisraqmslqqelryiealsaivetgqkmleagesaldvvteavrlle
ecplfnagigavftrdetheldacvmdgntlkagavagvshlrnpvlaarlvmeqsphvm
migegaenfafargmervspeifstslryeqllaarkegatvldhsgapldekqkmg
Download sequence
Identical sequences 1jn9_A 1jn9_C 1k2x_A 1k2x_C 1t3m_A 1t3m_C 1k2xA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]