SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1k5cA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1k5cA
Domain Number 1 Region: 17-319
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.07e-69
Family Galacturonase 0.000000000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1k5cA   PDB: 1k5c   SUPERFAMILY: 1k5cA
Sequence length 335
Comment (A:)
Sequence
atctvksvddakdiagcsavtlngftvpagntlvlnpdkgatvtmagditfakttldgpl
ftidgtginfvgadhifdgngalywdgkgtnngthkphpflkikgsgtykkfevlnspaq
aisvgptdahltldgitvddfagdtknlghntdgfdvsannvtiqncivknqddciaind
gnnirfennqcsgghgisigsiatgkhvsnvvikgntvtrsmygvrikaqrtatsasvsg
vtydantisgiakygvlisqsypddvgnpgtgapfsdvnftggattikvnnaatrvtvec
gncsgnwnwsqltvtggkagtiksdkakitggqyl
Download sequence
Identical sequences 1k5c_A 1kcc_A 1kcd_A 1k5cA cath|current|1k5cA00/3-335 cath|current|1kccA00/3-335 cath|current|1kcdA00/3-335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]