SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1k61A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1k61A
Domain Number 1 Region: 3-58
Classification Level Classification E-value
Superfamily Homeodomain-like 1.18e-16
Family Homeodomain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1k61A   PDB: 1k61   SUPERFAMILY: 1k61A
Sequence length 60
Comment (A:)
Sequence
rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkektit
Download sequence
Identical sequences 1k61A 1k61_A 1k61_B 1k61_C 1k61_D 000002455|e1k61A1|101.1.1.76|A:1-60 cath|current|1k61A00/132-191 cath|current|1k61B00/132-190 cath|current|1k61C00/134-189 cath|current|1k61D00/132-189 d1k61a_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]