SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1k78A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1k78A
Domain Number 1 Region: 18-140
Classification Level Classification E-value
Superfamily Homeodomain-like 3.88e-41
Family Paired domain 0.00000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1k78A   PDB: 1k78
Sequence length 149
Comment (A:)
Sequence
mdleknyptprtsrtghggvnqlggvfvngrplpdvvrqrivelahqgvrpcdisrqlrv
shgcvskilgryyetgsikpgviggskpkvatpkvvekiaeykrqnptmfaweirdrlla
ervcdndtvpsvssinriirtkvqqppnq
Download sequence
Identical sequences 1k78A 1k78_A 1k78_E 1k78_I 1mdm_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]