SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1k7kA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1k7kA
Domain Number 1 Region: 25-216
Classification Level Classification E-value
Superfamily ITPase-like 2.18e-117
Family ITPase (Ham1) 0.00000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1k7kA   PDB: 1k7k   SUPERFAMILY: 1k7kA
Sequence length 221
Comment (A:)
Sequence
mgsshhhhhhssgrenlyfqghmqkvvlatgnvgkvrelasllsdfgldivaqtdlgvds
aeetgltfienailkarhaakvtalpaiaddsglavdvlggapgiysarysgedatdqkn
lqklletmkdvpddqrqarfhcvlvylrhaedptplvchgswpgvitrepagtggfgydp
iffvpsegktaaeltreeksaishrgqalkllldalrnggs
Download sequence
Identical sequences 1k7k_A 1k7kA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]