SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1k87A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1k87A
Domain Number 1 Region: 262-618
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.59e-124
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00000000000335
Further Details:      
 
Domain Number 2 Region: 88-261
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.7e-67
Family N-terminal domain of bifunctional PutA protein 0.0000000186
Further Details:      
 
Domain Number 3 Region: 3-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0000000000445
Family PutA pre-N-terminal region-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1k87A   PDB: 1k87
Sequence length 669
Comment (A:)
Sequence
mgtttmgvklddatreriksaatridrtphwlikqaifsyleqlensdtlpelpallsga
anesdeaptpaeephqpfldfaeqilpqsvsraaitaayrrpeteavsmlleqarlpqpv
aeqahklayqladklrnqknasgragmvqgllqefslssqegvalmclaeallripdkat
rdalirdkisngnwqshigrspslfvnaatwgllftgklvsthneaslsrslnriigksg
eplirkgvdmamrlmgeqfvtgetiaealanarkleekgfrysydmlgeaaltaadaqay
mvsyqqaihaigkasngrgiyegpgisiklsalhprysraqydrvmeelyprlksltlla
rqydiginidaeeadrleisldlleklcfepelagwngigfviqayqkrcplvidylidl
atrsrrrlmirlvkgaywdseikraqmdglegypvytrkvytdvsylacakkllavpnli
ypqfathnahtlaaiyqlagqnyypgqyefqclhgmgeplyeqvtgkvadgklnrpcriy
apvgthetllaylvrrllengantsfvnriadtslpldelvadpvtaveklaqqegqtgl
phpkiplprdlyghgrdnsagldlanehrlaslssallnsalqkwqalpmleqpvaagem
spvinpaep
Download sequence
Identical sequences 1k87A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]