SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1k8bA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1k8bA
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily Translation initiation factor 2 beta, aIF2beta, N-terminal domain 1.32e-18
Family Translation initiation factor 2 beta, aIF2beta, N-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1k8bA   PDB: 1k8b   SUPERFAMILY: 1k8bA
Sequence length 52
Comment (A:)
Sequence
eiliegnrtiirnfrelakavnrdeeffakyllketgsagnleggrlilqrr
Download sequence
Identical sequences 001038507|e1k8bA1|101.1.2.226|A:1-52 cath|current|1k8bA00/39-90 d1k8ba_ 1k8bA 1k8b_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]