SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1k92A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1k92A
Domain Number 1 Region: 188-415
Classification Level Classification E-value
Superfamily Argininosuccinate synthetase, C-terminal domain 7.25e-109
Family Argininosuccinate synthetase, C-terminal domain 0.0000000138
Further Details:      
 
Domain Number 2 Region: 2-185
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 9.91e-35
Family N-type ATP pyrophosphatases 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1k92A   PDB: 1k92
Sequence length 455
Comment (A:)
Sequence
ttilkhlpvgqrigiafsggldtsaallwmrqkgavpyaytanlgqpdeedydaiprram
eygaenarlidcrkqlvaegiaaiqcgafhnttggltyfnttplgravtgtmlvaamked
gvniwgdgstykgndierfyryglltnaelqiykpwldtdfidelggrhemsefmiacgf
dykmsvekaystdsnmlgatheakdleylnssvkivnpimgvkfwdesvkipaeevtvrf
eqghpvalngktfsddvemmleanriggrhglgmsdqienriieaksrgiyeapgmallh
iayerlltgihnedtieqyhahgrqlgrllyqgrwfdsqalmlrdslqrwvasqitgevt
lelrrgndysilntvsenltykperltmekgdsvfspddrigqltmrnlditdtreklfg
yaktgllsssaasgvpqvenlenkgqsvehhhhhh
Download sequence
Identical sequences 1k92_A 1k97_A 1kp2_A 1kp3_A 1k92A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]