SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1kdhA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1kdhA
Domain Number 1 Region: 157-362
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.42e-68
Family DNA polymerase beta-like 0.000000218
Further Details:      
 
Domain Number 2 Region: 3-93
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 2.93e-30
Family DNA polymerase beta, N-terminal domain-like 0.0000632
Further Details:      
 
Domain Number 3 Region: 96-154
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 1.74e-18
Family DNA polymerase beta-like, second domain 0.0000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1kdhA   PDB: 1kdh
Sequence length 363
Comment (A:)
Sequence
kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits
mkdtegipclgdkvksiiegiiedgesseakavlnderyksfklftsvfgvglktaekwf
rmgfrtlskiqsdkslrftqmqkagflyyedlvscvnrpeaeavsmlvkeavvtflpdal
vtmtggfrrgkmtghdvdflitspeatedeeqqllhkvtdfwkqqglllycdilestfek
fkqpsrkvdaldhfqkcflilkldhgrvhseksgqqegkgwkairvdlvmcpydrrafal
lgwtgsrqferdlrryatherkmmldnhalydrtkrvfleaeseeeifahlgldyiepwe
rna
Download sequence
Identical sequences 1kdhA 1kdh_A 1kej_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]