SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1kioA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1kioA
Domain Number 1 Region: 1-34
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00000000000102
Family PMP inhibitors 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1kioA   PDB: 1kio   SUPERFAMILY: 1kioA
Sequence length 35
Comment (A:)
Sequence
evtcepgttfkdkcntcrcgsdgksaactrmacpq
Download sequence
Identical sequences 1kioA 1kio_A d1kioa_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]