SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1kmmA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1kmmA
Domain Number 1 Region: 5-318
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.35e-106
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000000147
Further Details:      
 
Domain Number 2 Region: 329-423
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.11e-25
Family Anticodon-binding domain of Class II aaRS 0.0000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1kmmA   PDB: 1kmm
Sequence length 424
Comment (A:)
Sequence
MAKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVT
DVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKG
RYRQFHQLGCEVFGLQGPDIDAELIMLTARWWRALGISEHVTLELNSIGSLEARANYRDA
LVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFAGL
CKLLESAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSQGTVCAGGRYDGLVEQLGGRAT
PAVGFAMGLERLVLLVQAVNPEFKADPVVDIYLVASGADTQSAAMALAERLRDELPGVKL
MTNHGGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLR
TLLG
Download sequence
Identical sequences A0A023Z150 A0A025CDB5 A0A027TYS9 A0A028ASS9 A0A028E2T0 A0A029HQN6 A0A029INX8 A0A062Y9X0 A0A069XLZ1 A0A070FNZ3 A0A070SQK6 A0A070V005 A0A073HAR8 A0A073UQW0 A0A080IRF5 A0A0A0FD75 A0A0A8UHP5 A0A0E0U1M7 A0A0E0V841 A0A0E1M061 A0A0E1SWP0 A0A0E2LHI0 A0A0F6C7J4 A0A0F6FAM5 A0A0G3K5K5 A0A0H3EN28 A0A0H3PM42 A0A0M9J735 A0A140N6J6 A0A142H5D5 A0A181WPQ7 A0A1E2VS37 A0A1E3MYT3 A0A1H0LC32 A0A1S9JJP0 A0A1X3IKM6 A0A1X3JF47 A0A1X3K9L7 A0A1X3L097 A0A1X3LG81 A0A1Z3V118 A1AE52 A7ZPV7 A8A320 B1IWE7 B1LNG9 B1XAY9 B5Z0Y3 B7M7L8 B7MHZ9 B7MYE9 B7NRG4 C3SZX2 C4ZX89 C8U833 C8UE82 D3H3M4 D3QN01 D6IAE3 D6JCY7 D7XMY6 D7ZID8 D8AEI6 D8E2G1 E0J1D3 E1INC7 E1J3J3 E3PG58 E6BGT8 E7SY00 E9XJW7 E9YR34 F3WKQ1 F4VEY3 G0FFY1 H4UMF0 I0VTE3 I2RHS5 I2SXM8 I2UTD9 I2WI65 I2WW42 I2XCA7 J7R485 K4V5S1 K4W4V7 L2UZA1 L2XHC9 L3C5L9 L4J2P7 L4V8Y3 M9H2M3 P60906 P60907 P60908 Q0TEX1 Q1R8L9 S0VWF2 S0Y095 S0YKP6 S1CT55 S1EFW5 S1H493 S1ID39 S1ID67 T5U4I0 T6M7T1 T9AAP2 T9CSS5 T9SM48 U9XQQ8 U9YCT5 U9ZSR9 V0SQ88 V0VPB5 V0XCB0 V0YFH6 V2RGW7 V2SX41 V6FX65 V8FJD8 W1AY82 W1ETE5 W1WMR8
gi|157161989|ref|YP_001459307.1| gi|386603446|ref|YP_006109746.1| gi|443618569|ref|YP_007382425.1| gi|260869203|ref|YP_003235605.1| gi|238901679|ref|YP_002927475.1| gi|26248878|ref|NP_754918.1| gi|260856608|ref|YP_003230499.1| gi|218555039|ref|YP_002387952.1| gi|387622214|ref|YP_006129842.1| gi|387608164|ref|YP_006097020.1| gi|218701024|ref|YP_002408653.1| gi|170682103|ref|YP_001744702.1| gi|386600492|ref|YP_006101998.1| gi|260845144|ref|YP_003222922.1| gi|387507879|ref|YP_006160135.1| gi|251785839|ref|YP_003000143.1| gi|254794460|ref|YP_003079297.1| gi|386710404|ref|YP_006174125.1| gi|471334186|ref|YP_007557663.1| 155864.Z3777 199310.c3036 316385.ECDH10B_2680 316407.hisS 331111.EcE24377A_2798 331112.EcHS_A2665 362663.ECP_2519 364106.UTI89_C2835 386585.ECs3376 405955.APECO1_4010 413997.ECB_02406 439855.EcSMS35_2666 444450.ECH74115_3738 469008.ECBD_1172 481805.EcolC_1163 511145.b2514 544404.ECSP_3454 573235.ECO26_3561 585034.ECIAI1_2566 585035.ECS88_2690 585057.ECIAI39_2715 585395.ECO103_3031 585396.ECO111_3238 585397.ECED1_2945 595496.BWG_2278 NP_311403.1.58667 NP_417009.1.90541 WP_001107167.1.10001 WP_001107167.1.100044 WP_001107167.1.100073 WP_001107167.1.10010 WP_001107167.1.100159 WP_001107167.1.100220 WP_001107167.1.100252 WP_001107167.1.100283 WP_001107167.1.100285 WP_001107167.1.100299 WP_001107167.1.100302 WP_001107167.1.100306 WP_001107167.1.100425 WP_001107167.1.100444 WP_001107167.1.100451 WP_001107167.1.100487 WP_001107167.1.100496 WP_001107167.1.100508 WP_001107167.1.100531 WP_001107167.1.100554 WP_001107167.1.100571 WP_001107167.1.100614 WP_001107167.1.10067 WP_001107167.1.100735 WP_001107167.1.100738 WP_001107167.1.100753 WP_001107167.1.100758 WP_001107167.1.100778 WP_001107167.1.100803 WP_001107167.1.100836 WP_001107167.1.10086 WP_001107167.1.100867 WP_001107167.1.100868 WP_001107167.1.100898 WP_001107167.1.100916 WP_001107167.1.100925 WP_001107167.1.10094 WP_001107167.1.100966 WP_001107167.1.100990 WP_001107167.1.101033 WP_001107167.1.101052 WP_001107167.1.101096 WP_001107167.1.101105 WP_001107167.1.101110 WP_001107167.1.101152 WP_001107167.1.101157 WP_001107167.1.101158 WP_001107167.1.101166 WP_001107167.1.101186 WP_001107167.1.101206 WP_001107167.1.101216 WP_001107167.1.101257 WP_001107167.1.101282 WP_001107167.1.101289 WP_001107167.1.10131 WP_001107167.1.10138 WP_001107167.1.101387 WP_001107167.1.101418 WP_001107167.1.101423 WP_001107167.1.101429 WP_001107167.1.101439 WP_001107167.1.101468 WP_001107167.1.10154 WP_001107167.1.101628 WP_001107167.1.101630 WP_001107167.1.101653 WP_001107167.1.101654 WP_001107167.1.101668 WP_001107167.1.101693 WP_001107167.1.101694 WP_001107167.1.101700 WP_001107167.1.101727 WP_001107167.1.10173 WP_001107167.1.101737 WP_001107167.1.101769 WP_001107167.1.101777 WP_001107167.1.101786 WP_001107167.1.101840 WP_001107167.1.101865 WP_001107167.1.10187 WP_001107167.1.10188 WP_001107167.1.10190 WP_001107167.1.101900 WP_001107167.1.101913 WP_001107167.1.101926 WP_001107167.1.101947 WP_001107167.1.101952 WP_001107167.1.101962 WP_001107167.1.101977 WP_001107167.1.101984 WP_001107167.1.10206 WP_001107167.1.102069 WP_001107167.1.102076 WP_001107167.1.102094 WP_001107167.1.102106 WP_001107167.1.102122 WP_001107167.1.102139 WP_001107167.1.102144 WP_001107167.1.10233 WP_001107167.1.10235 WP_001107167.1.10252 WP_001107167.1.10273 WP_001107167.1.10304 WP_001107167.1.10326 WP_001107167.1.10335 WP_001107167.1.10379 WP_001107167.1.10381 WP_001107167.1.10400 WP_001107167.1.10417 WP_001107167.1.10461 WP_001107167.1.10476 WP_001107167.1.10491 WP_001107167.1.10492 WP_001107167.1.10496 WP_001107167.1.10524 WP_001107167.1.10538 WP_001107167.1.10569 WP_001107167.1.10579 WP_001107167.1.1058 WP_001107167.1.10605 WP_001107167.1.10607 WP_001107167.1.10673 WP_001107167.1.10697 WP_001107167.1.10729 WP_001107167.1.1073 WP_001107167.1.1074 WP_001107167.1.10744 WP_001107167.1.10748 WP_001107167.1.10761 WP_001107167.1.10763 WP_001107167.1.10786 WP_001107167.1.10798 WP_001107167.1.10809 WP_001107167.1.10824 WP_001107167.1.10833 WP_001107167.1.10869 WP_001107167.1.10922 WP_001107167.1.10970 WP_001107167.1.10988 WP_001107167.1.11032 WP_001107167.1.11047 WP_001107167.1.11052 WP_001107167.1.11057 WP_001107167.1.11068 WP_001107167.1.11071 WP_001107167.1.1111 WP_001107167.1.11113 WP_001107167.1.1113 WP_001107167.1.11133 WP_001107167.1.11217 WP_001107167.1.1122 WP_001107167.1.11240 WP_001107167.1.11241 WP_001107167.1.11250 WP_001107167.1.11265 WP_001107167.1.11285 WP_001107167.1.11301 WP_001107167.1.11399 WP_001107167.1.11408 WP_001107167.1.11411 WP_001107167.1.11418 WP_001107167.1.11420 WP_001107167.1.11436 WP_001107167.1.11437 WP_001107167.1.11467 WP_001107167.1.11519 WP_001107167.1.11531 WP_001107167.1.11542 WP_001107167.1.11575 WP_001107167.1.11578 WP_001107167.1.11608 WP_001107167.1.11616 WP_001107167.1.11671 WP_001107167.1.11690 WP_001107167.1.11699 WP_001107167.1.11748 WP_001107167.1.11759 WP_001107167.1.11803 WP_001107167.1.11844 WP_001107167.1.11949 WP_001107167.1.11956 WP_001107167.1.1196 WP_001107167.1.11981 WP_001107167.1.11982 WP_001107167.1.12009 WP_001107167.1.12010 WP_001107167.1.12030 WP_001107167.1.12051 WP_001107167.1.12060 WP_001107167.1.12076 WP_001107167.1.12111 WP_001107167.1.1212 WP_001107167.1.12230 WP_001107167.1.12259 WP_001107167.1.12268 WP_001107167.1.12279 WP_001107167.1.12295 WP_001107167.1.12305 WP_001107167.1.12319 WP_001107167.1.12320 WP_001107167.1.12342 WP_001107167.1.1242 WP_001107167.1.12459 WP_001107167.1.12468 WP_001107167.1.12478 WP_001107167.1.12552 WP_001107167.1.12558 WP_001107167.1.12582 WP_001107167.1.12594 WP_001107167.1.12645 WP_001107167.1.12646 WP_001107167.1.12679 WP_001107167.1.12680 WP_001107167.1.12693 WP_001107167.1.127 WP_001107167.1.12709 WP_001107167.1.12743 WP_001107167.1.12749 WP_001107167.1.12756 WP_001107167.1.12761 WP_001107167.1.12762 WP_001107167.1.12763 WP_001107167.1.12766 WP_001107167.1.12775 WP_001107167.1.1278 WP_001107167.1.12781 WP_001107167.1.12826 WP_001107167.1.12831 WP_001107167.1.12876 WP_001107167.1.12914 WP_001107167.1.12915 WP_001107167.1.12917 WP_001107167.1.1295 WP_001107167.1.12987 WP_001107167.1.13002 WP_001107167.1.13015 WP_001107167.1.13031 WP_001107167.1.13060 WP_001107167.1.13074 WP_001107167.1.1308 WP_001107167.1.1312 WP_001107167.1.13162 WP_001107167.1.13176 WP_001107167.1.13181 WP_001107167.1.13217 WP_001107167.1.13222 WP_001107167.1.13223 WP_001107167.1.1323 WP_001107167.1.13239 WP_001107167.1.13252 WP_001107167.1.13272 WP_001107167.1.13278 WP_001107167.1.13281 WP_001107167.1.13332 WP_001107167.1.13333 WP_001107167.1.13348 WP_001107167.1.1335 WP_001107167.1.13409 WP_001107167.1.1343 WP_001107167.1.13430 WP_001107167.1.13437 WP_001107167.1.13442 WP_001107167.1.1345 WP_001107167.1.13469 WP_001107167.1.13473 WP_001107167.1.13481 WP_001107167.1.13492 WP_001107167.1.13495 WP_001107167.1.13525 WP_001107167.1.13585 WP_001107167.1.13608 WP_001107167.1.13618 WP_001107167.1.13624 WP_001107167.1.13626 WP_001107167.1.13644 WP_001107167.1.13664 WP_001107167.1.13672 WP_001107167.1.13778 WP_001107167.1.13824 WP_001107167.1.13877 WP_001107167.1.13881 WP_001107167.1.13924 WP_001107167.1.13936 WP_001107167.1.13939 WP_001107167.1.13944 WP_001107167.1.13949 WP_001107167.1.13974 WP_001107167.1.14058 WP_001107167.1.14062 WP_001107167.1.14110 WP_001107167.1.14144 WP_001107167.1.14164 WP_001107167.1.1419 WP_001107167.1.14245 WP_001107167.1.14277 WP_001107167.1.14292 WP_001107167.1.14304 WP_001107167.1.14322 WP_001107167.1.14331 WP_001107167.1.14371 WP_001107167.1.1438 WP_001107167.1.1439 WP_001107167.1.14417 WP_001107167.1.14445 WP_001107167.1.14453 WP_001107167.1.14468 WP_001107167.1.14493 WP_001107167.1.14501 WP_001107167.1.14509 WP_001107167.1.14529 WP_001107167.1.14536 WP_001107167.1.14538 WP_001107167.1.14582 WP_001107167.1.14600 WP_001107167.1.14601 WP_001107167.1.14616 WP_001107167.1.14621 WP_001107167.1.14661 WP_001107167.1.14672 WP_001107167.1.14678 WP_001107167.1.14687 WP_001107167.1.14693 WP_001107167.1.1470 WP_001107167.1.14712 WP_001107167.1.14748 WP_001107167.1.14811 WP_001107167.1.14833 WP_001107167.1.14871 WP_001107167.1.14879 WP_001107167.1.14914 WP_001107167.1.14946 WP_001107167.1.14977 WP_001107167.1.14992 WP_001107167.1.14993 WP_001107167.1.15020 WP_001107167.1.15087 WP_001107167.1.15117 WP_001107167.1.1512 WP_001107167.1.15138 WP_001107167.1.15177 WP_001107167.1.15193 WP_001107167.1.1524 WP_001107167.1.15270 WP_001107167.1.15274 WP_001107167.1.15282 WP_001107167.1.15300 WP_001107167.1.15332 WP_001107167.1.15335 WP_001107167.1.15347 WP_001107167.1.15356 WP_001107167.1.15416 WP_001107167.1.15420 WP_001107167.1.1543 WP_001107167.1.15453 WP_001107167.1.15469 WP_001107167.1.15496 WP_001107167.1.1550 WP_001107167.1.15503 WP_001107167.1.15527 WP_001107167.1.15528 WP_001107167.1.15538 WP_001107167.1.15576 WP_001107167.1.1559 WP_001107167.1.15593 WP_001107167.1.1561 WP_001107167.1.15624 WP_001107167.1.15626 WP_001107167.1.15702 WP_001107167.1.15740 WP_001107167.1.15752 WP_001107167.1.15782 WP_001107167.1.15791 WP_001107167.1.1582 WP_001107167.1.15857 WP_001107167.1.1588 WP_001107167.1.15906 WP_001107167.1.15916 WP_001107167.1.15949 WP_001107167.1.15983 WP_001107167.1.15984 WP_001107167.1.16010 WP_001107167.1.16075 WP_001107167.1.16086 WP_001107167.1.1609 WP_001107167.1.16102 WP_001107167.1.16111 WP_001107167.1.16133 WP_001107167.1.16154 WP_001107167.1.16171 WP_001107167.1.16175 WP_001107167.1.1621 WP_001107167.1.1622 WP_001107167.1.16222 WP_001107167.1.16270 WP_001107167.1.16272 WP_001107167.1.16294 WP_001107167.1.163 WP_001107167.1.16322 WP_001107167.1.16387 WP_001107167.1.1640 WP_001107167.1.16435 WP_001107167.1.16463 WP_001107167.1.16481 WP_001107167.1.16500 WP_001107167.1.16517 WP_001107167.1.16539 WP_001107167.1.16541 WP_001107167.1.1655 WP_001107167.1.16577 WP_001107167.1.16592 WP_001107167.1.16608 WP_001107167.1.16612 WP_001107167.1.16648 WP_001107167.1.16667 WP_001107167.1.16705 WP_001107167.1.16715 WP_001107167.1.16799 WP_001107167.1.16805 WP_001107167.1.16843 WP_001107167.1.16845 WP_001107167.1.16861 WP_001107167.1.16927 WP_001107167.1.16979 WP_001107167.1.16992 WP_001107167.1.17017 WP_001107167.1.17018 WP_001107167.1.17061 WP_001107167.1.17084 WP_001107167.1.17087 WP_001107167.1.1710 WP_001107167.1.17111 WP_001107167.1.17114 WP_001107167.1.17119 WP_001107167.1.17123 WP_001107167.1.17150 WP_001107167.1.17153 WP_001107167.1.17187 WP_001107167.1.17216 WP_001107167.1.17242 WP_001107167.1.17267 WP_001107167.1.17282 WP_001107167.1.17297 WP_001107167.1.1731 WP_001107167.1.17325 WP_001107167.1.17333 WP_001107167.1.17356 WP_001107167.1.17360 WP_001107167.1.17373 WP_001107167.1.17386 WP_001107167.1.17392 WP_001107167.1.17415 WP_001107167.1.17417 WP_001107167.1.17432 WP_001107167.1.17461 WP_001107167.1.17464 WP_001107167.1.17496 WP_001107167.1.17515 WP_001107167.1.17577 WP_001107167.1.17584 WP_001107167.1.17595 WP_001107167.1.17623 WP_001107167.1.1763 WP_001107167.1.17637 WP_001107167.1.1769 WP_001107167.1.17701 WP_001107167.1.17757 WP_001107167.1.17802 WP_001107167.1.17829 WP_001107167.1.17831 WP_001107167.1.17849 WP_001107167.1.17889 WP_001107167.1.17904 WP_001107167.1.17937 WP_001107167.1.17952 WP_001107167.1.17963 WP_001107167.1.17984 WP_001107167.1.18006 WP_001107167.1.1802 WP_001107167.1.18050 WP_001107167.1.18094 WP_001107167.1.18112 WP_001107167.1.18118 WP_001107167.1.18133 WP_001107167.1.18134 WP_001107167.1.18136 WP_001107167.1.18175 WP_001107167.1.1821 WP_001107167.1.18226 WP_001107167.1.18275 WP_001107167.1.18316 WP_001107167.1.18326 WP_001107167.1.18329 WP_001107167.1.18338 WP_001107167.1.1834 WP_001107167.1.18340 WP_001107167.1.18381 WP_001107167.1.18402 WP_001107167.1.18410 WP_001107167.1.18436 WP_001107167.1.18438 WP_001107167.1.1844 WP_001107167.1.18472 WP_001107167.1.18530 WP_001107167.1.18550 WP_001107167.1.18588 WP_001107167.1.18649 WP_001107167.1.18651 WP_001107167.1.18655 WP_001107167.1.1866 WP_001107167.1.1867 WP_001107167.1.18699 WP_001107167.1.18714 WP_001107167.1.18726 WP_001107167.1.1873 WP_001107167.1.18734 WP_001107167.1.18794 WP_001107167.1.188 WP_001107167.1.18801 WP_001107167.1.18802 WP_001107167.1.1881 WP_001107167.1.18837 WP_001107167.1.18858 WP_001107167.1.18874 WP_001107167.1.18876 WP_001107167.1.18908 WP_001107167.1.18923 WP_001107167.1.18934 WP_001107167.1.18936 WP_001107167.1.18962 WP_001107167.1.18966 WP_001107167.1.18995 WP_001107167.1.19036 WP_001107167.1.19039 WP_001107167.1.19075 WP_001107167.1.191 WP_001107167.1.19114 WP_001107167.1.19135 WP_001107167.1.19140 WP_001107167.1.19146 WP_001107167.1.19150 WP_001107167.1.19171 WP_001107167.1.19194 WP_001107167.1.19205 WP_001107167.1.19206 WP_001107167.1.1925 WP_001107167.1.19277 WP_001107167.1.19297 WP_001107167.1.193 WP_001107167.1.19313 WP_001107167.1.19314 WP_001107167.1.19332 WP_001107167.1.19347 WP_001107167.1.19350 WP_001107167.1.19361 WP_001107167.1.19379 WP_001107167.1.19389 WP_001107167.1.19397 WP_001107167.1.19419 WP_001107167.1.19424 WP_001107167.1.19441 WP_001107167.1.19478 WP_001107167.1.19492 WP_001107167.1.19494 WP_001107167.1.19534 WP_001107167.1.19557 WP_001107167.1.19583 WP_001107167.1.1960 WP_001107167.1.1963 WP_001107167.1.19644 WP_001107167.1.19649 WP_001107167.1.19654 WP_001107167.1.19655 WP_001107167.1.19661 WP_001107167.1.19684 WP_001107167.1.19691 WP_001107167.1.19760 WP_001107167.1.19761 WP_001107167.1.19795 WP_001107167.1.1982 WP_001107167.1.19840 WP_001107167.1.19847 WP_001107167.1.19861 WP_001107167.1.1987 WP_001107167.1.19878 WP_001107167.1.19940 WP_001107167.1.19957 WP_001107167.1.19972 WP_001107167.1.19994 WP_001107167.1.2005 WP_001107167.1.20115 WP_001107167.1.20129 WP_001107167.1.20151 WP_001107167.1.20164 WP_001107167.1.20170 WP_001107167.1.20183 WP_001107167.1.20251 WP_001107167.1.2027 WP_001107167.1.20277 WP_001107167.1.20289 WP_001107167.1.20308 WP_001107167.1.20318 WP_001107167.1.20325 WP_001107167.1.20331 WP_001107167.1.20334 WP_001107167.1.20388 WP_001107167.1.20445 WP_001107167.1.20449 WP_001107167.1.20452 WP_001107167.1.20480 WP_001107167.1.20506 WP_001107167.1.20515 WP_001107167.1.20519 WP_001107167.1.20536 WP_001107167.1.20546 WP_001107167.1.20594 WP_001107167.1.20596 WP_001107167.1.20609 WP_001107167.1.2063 WP_001107167.1.20638 WP_001107167.1.20640 WP_001107167.1.20662 WP_001107167.1.20691 WP_001107167.1.20709 WP_001107167.1.20724 WP_001107167.1.20737 WP_001107167.1.20745 WP_001107167.1.20761 WP_001107167.1.20765 WP_001107167.1.20784 WP_001107167.1.20785 WP_001107167.1.20803 WP_001107167.1.20818 WP_001107167.1.20824 WP_001107167.1.20848 WP_001107167.1.20863 WP_001107167.1.20893 WP_001107167.1.2092 WP_001107167.1.2094 WP_001107167.1.20941 WP_001107167.1.20943 WP_001107167.1.20950 WP_001107167.1.20962 WP_001107167.1.20989 WP_001107167.1.2100 WP_001107167.1.21017 WP_001107167.1.21020 WP_001107167.1.21033 WP_001107167.1.21041 WP_001107167.1.21057 WP_001107167.1.21104 WP_001107167.1.21137 WP_001107167.1.21251 WP_001107167.1.2142 WP_001107167.1.21441 WP_001107167.1.21450 WP_001107167.1.21508 WP_001107167.1.21519 WP_001107167.1.2156 WP_001107167.1.21614 WP_001107167.1.21634 WP_001107167.1.2164 WP_001107167.1.21652 WP_001107167.1.21656 WP_001107167.1.21661 WP_001107167.1.21666 WP_001107167.1.21667 WP_001107167.1.21668 WP_001107167.1.21714 WP_001107167.1.21729 WP_001107167.1.21732 WP_001107167.1.21756 WP_001107167.1.21812 WP_001107167.1.21823 WP_001107167.1.21899 WP_001107167.1.21915 WP_001107167.1.21948 WP_001107167.1.21962 WP_001107167.1.21986 WP_001107167.1.21992 WP_001107167.1.22021 WP_001107167.1.22042 WP_001107167.1.22060 WP_001107167.1.22088 WP_001107167.1.22113 WP_001107167.1.22138 WP_001107167.1.2218 WP_001107167.1.22182 WP_001107167.1.22189 WP_001107167.1.22195 WP_001107167.1.22251 WP_001107167.1.22280 WP_001107167.1.22291 WP_001107167.1.22293 WP_001107167.1.22304 WP_001107167.1.22314 WP_001107167.1.22325 WP_001107167.1.22359 WP_001107167.1.22363 WP_001107167.1.22381 WP_001107167.1.22431 WP_001107167.1.2245 WP_001107167.1.22450 WP_001107167.1.22544 WP_001107167.1.22549 WP_001107167.1.22572 WP_001107167.1.22574 WP_001107167.1.22579 WP_001107167.1.22594 WP_001107167.1.22599 WP_001107167.1.22602 WP_001107167.1.22631 WP_001107167.1.22649 WP_001107167.1.22662 WP_001107167.1.22667 WP_001107167.1.22669 WP_001107167.1.22691 WP_001107167.1.22743 WP_001107167.1.22756 WP_001107167.1.22757 WP_001107167.1.22759 WP_001107167.1.22765 WP_001107167.1.22777 WP_001107167.1.22783 WP_001107167.1.22830 WP_001107167.1.22868 WP_001107167.1.22875 WP_001107167.1.22878 WP_001107167.1.22885 WP_001107167.1.22925 WP_001107167.1.22939 WP_001107167.1.2300 WP_001107167.1.23005 WP_001107167.1.23026 WP_001107167.1.23035 WP_001107167.1.23044 WP_001107167.1.23073 WP_001107167.1.23078 WP_001107167.1.23105 WP_001107167.1.23115 WP_001107167.1.23135 WP_001107167.1.23230 WP_001107167.1.23241 WP_001107167.1.23282 WP_001107167.1.23285 WP_001107167.1.23290 WP_001107167.1.23299 WP_001107167.1.23323 WP_001107167.1.23330 WP_001107167.1.23355 WP_001107167.1.23378 WP_001107167.1.23383 WP_001107167.1.23435 WP_001107167.1.23467 WP_001107167.1.23486 WP_001107167.1.23487 WP_001107167.1.23511 WP_001107167.1.23520 WP_001107167.1.23527 WP_001107167.1.23549 WP_001107167.1.23575 WP_001107167.1.23593 WP_001107167.1.2362 WP_001107167.1.23625 WP_001107167.1.23640 WP_001107167.1.23676 WP_001107167.1.23686 WP_001107167.1.23693 WP_001107167.1.23700 WP_001107167.1.23724 WP_001107167.1.23741 WP_001107167.1.23754 WP_001107167.1.23765 WP_001107167.1.23790 WP_001107167.1.23806 WP_001107167.1.23812 WP_001107167.1.23838 WP_001107167.1.23855 WP_001107167.1.23869 WP_001107167.1.2388 WP_001107167.1.23895 WP_001107167.1.23898 WP_001107167.1.23899 WP_001107167.1.23915 WP_001107167.1.23950 WP_001107167.1.23960 WP_001107167.1.23962 WP_001107167.1.23973 WP_001107167.1.23984 WP_001107167.1.23985 WP_001107167.1.24004 WP_001107167.1.24024 WP_001107167.1.24038 WP_001107167.1.24045 WP_001107167.1.24068 WP_001107167.1.24070 WP_001107167.1.24088 WP_001107167.1.24089 WP_001107167.1.24122 WP_001107167.1.24124 WP_001107167.1.24169 WP_001107167.1.24177 WP_001107167.1.2418 WP_001107167.1.2428 WP_001107167.1.24283 WP_001107167.1.2430 WP_001107167.1.24304 WP_001107167.1.24316 WP_001107167.1.24341 WP_001107167.1.24362 WP_001107167.1.24374 WP_001107167.1.24381 WP_001107167.1.24383 WP_001107167.1.24458 WP_001107167.1.24460 WP_001107167.1.24485 WP_001107167.1.24499 WP_001107167.1.24523 WP_001107167.1.24524 WP_001107167.1.24577 WP_001107167.1.24583 WP_001107167.1.24592 WP_001107167.1.24616 WP_001107167.1.24634 WP_001107167.1.24641 WP_001107167.1.24642 WP_001107167.1.24646 WP_001107167.1.24650 WP_001107167.1.24693 WP_001107167.1.24695 WP_001107167.1.24753 WP_001107167.1.24758 WP_001107167.1.24763 WP_001107167.1.2479 WP_001107167.1.24797 WP_001107167.1.24808 WP_001107167.1.24854 WP_001107167.1.24870 WP_001107167.1.24876 WP_001107167.1.24929 WP_001107167.1.24939 WP_001107167.1.24946 WP_001107167.1.24960 WP_001107167.1.24968 WP_001107167.1.25019 WP_001107167.1.2502 WP_001107167.1.25021 WP_001107167.1.2504 WP_001107167.1.25042 WP_001107167.1.25076 WP_001107167.1.25079 WP_001107167.1.25082 WP_001107167.1.25085 WP_001107167.1.25087 WP_001107167.1.25088 WP_001107167.1.2512 WP_001107167.1.25126 WP_001107167.1.25174 WP_001107167.1.25183 WP_001107167.1.25193 WP_001107167.1.25201 WP_001107167.1.25203 WP_001107167.1.25248 WP_001107167.1.25270 WP_001107167.1.25272 WP_001107167.1.25305 WP_001107167.1.2531 WP_001107167.1.25312 WP_001107167.1.25324 WP_001107167.1.25378 WP_001107167.1.2540 WP_001107167.1.25414 WP_001107167.1.2543 WP_001107167.1.25525 WP_001107167.1.25526 WP_001107167.1.25548 WP_001107167.1.25577 WP_001107167.1.25592 WP_001107167.1.25612 WP_001107167.1.25613 WP_001107167.1.25643 WP_001107167.1.25680 WP_001107167.1.25712 WP_001107167.1.25713 WP_001107167.1.25724 WP_001107167.1.25726 WP_001107167.1.25794 WP_001107167.1.25819 WP_001107167.1.25831 WP_001107167.1.25832 WP_001107167.1.25886 WP_001107167.1.25945 WP_001107167.1.2597 WP_001107167.1.25996 WP_001107167.1.26040 WP_001107167.1.26048 WP_001107167.1.26055 WP_001107167.1.2606 WP_001107167.1.26061 WP_001107167.1.26066 WP_001107167.1.26092 WP_001107167.1.26100 WP_001107167.1.26105 WP_001107167.1.26121 WP_001107167.1.26134 WP_001107167.1.26161 WP_001107167.1.26175 WP_001107167.1.26186 WP_001107167.1.26196 WP_001107167.1.26246 WP_001107167.1.26264 WP_001107167.1.26284 WP_001107167.1.26325 WP_001107167.1.26331 WP_001107167.1.26379 WP_001107167.1.26398 WP_001107167.1.26401 WP_001107167.1.26419 WP_001107167.1.26438 WP_001107167.1.26474 WP_001107167.1.26480 WP_001107167.1.26517 WP_001107167.1.26525 WP_001107167.1.26569 WP_001107167.1.26574 WP_001107167.1.26579 WP_001107167.1.26588 WP_001107167.1.26590 WP_001107167.1.26627 WP_001107167.1.26644 WP_001107167.1.2665 WP_001107167.1.26659 WP_001107167.1.26660 WP_001107167.1.26683 WP_001107167.1.26688 WP_001107167.1.26716 WP_001107167.1.26761 WP_001107167.1.26782 WP_001107167.1.26837 WP_001107167.1.26861 WP_001107167.1.26878 WP_001107167.1.2688 WP_001107167.1.26932 WP_001107167.1.2694 WP_001107167.1.26941 WP_001107167.1.26943 WP_001107167.1.2695 WP_001107167.1.26975 WP_001107167.1.26998 WP_001107167.1.2700 WP_001107167.1.27019 WP_001107167.1.27098 WP_001107167.1.27134 WP_001107167.1.27141 WP_001107167.1.27148 WP_001107167.1.27175 WP_001107167.1.27188 WP_001107167.1.27234 WP_001107167.1.27260 WP_001107167.1.27280 WP_001107167.1.27283 WP_001107167.1.2731 WP_001107167.1.27313 WP_001107167.1.27330 WP_001107167.1.27338 WP_001107167.1.27367 WP_001107167.1.27424 WP_001107167.1.27445 WP_001107167.1.2745 WP_001107167.1.27451 WP_001107167.1.27504 WP_001107167.1.27518 WP_001107167.1.27560 WP_001107167.1.27585 WP_001107167.1.27611 WP_001107167.1.27693 WP_001107167.1.27698 WP_001107167.1.27723 WP_001107167.1.27741 WP_001107167.1.27742 WP_001107167.1.27758 WP_001107167.1.27774 WP_001107167.1.2779 WP_001107167.1.27797 WP_001107167.1.2782 WP_001107167.1.27861 WP_001107167.1.27871 WP_001107167.1.27876 WP_001107167.1.27879 WP_001107167.1.27897 WP_001107167.1.27923 WP_001107167.1.27932 WP_001107167.1.2794 WP_001107167.1.27971 WP_001107167.1.28008 WP_001107167.1.28051 WP_001107167.1.28109 WP_001107167.1.2811 WP_001107167.1.28110 WP_001107167.1.28128 WP_001107167.1.28143 WP_001107167.1.28145 WP_001107167.1.2826 WP_001107167.1.28268 WP_001107167.1.28271 WP_001107167.1.28305 WP_001107167.1.28314 WP_001107167.1.28318 WP_001107167.1.28322 WP_001107167.1.28345 WP_001107167.1.28371 WP_001107167.1.2838 WP_001107167.1.28401 WP_001107167.1.28496 WP_001107167.1.285 WP_001107167.1.28500 WP_001107167.1.28509 WP_001107167.1.28523 WP_001107167.1.28544 WP_001107167.1.28551 WP_001107167.1.2866 WP_001107167.1.28697 WP_001107167.1.28711 WP_001107167.1.28723 WP_001107167.1.28732 WP_001107167.1.28734 WP_001107167.1.28736 WP_001107167.1.28760 WP_001107167.1.28809 WP_001107167.1.2881 WP_001107167.1.28842 WP_001107167.1.28863 WP_001107167.1.28879 WP_001107167.1.28919 WP_001107167.1.28924 WP_001107167.1.28950 WP_001107167.1.28953 WP_001107167.1.28982 WP_001107167.1.28994 WP_001107167.1.290 WP_001107167.1.29001 WP_001107167.1.29013 WP_001107167.1.29016 WP_001107167.1.29026 WP_001107167.1.29049 WP_001107167.1.29055 WP_001107167.1.29082 WP_001107167.1.291 WP_001107167.1.29100 WP_001107167.1.29125 WP_001107167.1.29126 WP_001107167.1.29150 WP_001107167.1.29164 WP_001107167.1.29176 WP_001107167.1.29194 WP_001107167.1.29221 WP_001107167.1.29239 WP_001107167.1.29258 WP_001107167.1.2926 WP_001107167.1.29377 WP_001107167.1.29394 WP_001107167.1.29404 WP_001107167.1.29429 WP_001107167.1.2945 WP_001107167.1.29504 WP_001107167.1.29513 WP_001107167.1.29523 WP_001107167.1.2954 WP_001107167.1.29564 WP_001107167.1.29590 WP_001107167.1.29597 WP_001107167.1.29603 WP_001107167.1.29618 WP_001107167.1.2963 WP_001107167.1.29647 WP_001107167.1.29662 WP_001107167.1.29669 WP_001107167.1.29683 WP_001107167.1.29689 WP_001107167.1.29715 WP_001107167.1.29724 WP_001107167.1.29746 WP_001107167.1.29752 WP_001107167.1.2978 WP_001107167.1.29798 WP_001107167.1.29818 WP_001107167.1.29819 WP_001107167.1.29820 WP_001107167.1.29840 WP_001107167.1.29855 WP_001107167.1.29874 WP_001107167.1.29876 WP_001107167.1.29884 WP_001107167.1.2995 WP_001107167.1.29967 WP_001107167.1.29976 WP_001107167.1.29992 WP_001107167.1.30 WP_001107167.1.30004 WP_001107167.1.30019 WP_001107167.1.30035 WP_001107167.1.30052 WP_001107167.1.30064 WP_001107167.1.30098 WP_001107167.1.30105 WP_001107167.1.30164 WP_001107167.1.30247 WP_001107167.1.30253 WP_001107167.1.30269 WP_001107167.1.30298 WP_001107167.1.30391 WP_001107167.1.30397 WP_001107167.1.30400 WP_001107167.1.30447 WP_001107167.1.3045 WP_001107167.1.30452 WP_001107167.1.30472 WP_001107167.1.30476 WP_001107167.1.30479 WP_001107167.1.30497 WP_001107167.1.30524 WP_001107167.1.30536 WP_001107167.1.30546 WP_001107167.1.30554 WP_001107167.1.30570 WP_001107167.1.30637 WP_001107167.1.30639 WP_001107167.1.30658 WP_001107167.1.30733 WP_001107167.1.30742 WP_001107167.1.30749 WP_001107167.1.30762 WP_001107167.1.30783 WP_001107167.1.30808 WP_001107167.1.3083 WP_001107167.1.30843 WP_001107167.1.30853 WP_001107167.1.30866 WP_001107167.1.30887 WP_001107167.1.30896 WP_001107167.1.309 WP_001107167.1.30905 WP_001107167.1.30906 WP_001107167.1.30918 WP_001107167.1.30987 WP_001107167.1.30993 WP_001107167.1.30999 WP_001107167.1.31029 WP_001107167.1.31055 WP_001107167.1.31083 WP_001107167.1.31089 WP_001107167.1.31119 WP_001107167.1.31129 WP_001107167.1.31142 WP_001107167.1.31154 WP_001107167.1.312 WP_001107167.1.31211 WP_001107167.1.31252 WP_001107167.1.31319 WP_001107167.1.31340 WP_001107167.1.31347 WP_001107167.1.31357 WP_001107167.1.31379 WP_001107167.1.3140 WP_001107167.1.31401 WP_001107167.1.31407 WP_001107167.1.31429 WP_001107167.1.31431 WP_001107167.1.31433 WP_001107167.1.31506 WP_001107167.1.31518 WP_001107167.1.31521 WP_001107167.1.31559 WP_001107167.1.31575 WP_001107167.1.31618 WP_001107167.1.31657 WP_001107167.1.31681 WP_001107167.1.3169 WP_001107167.1.31715 WP_001107167.1.31740 WP_001107167.1.31803 WP_001107167.1.3181 WP_001107167.1.31823 WP_001107167.1.31825 WP_001107167.1.31833 WP_001107167.1.31839 WP_001107167.1.31860 WP_001107167.1.31863 WP_001107167.1.31866 WP_001107167.1.31898 WP_001107167.1.31928 WP_001107167.1.31956 WP_001107167.1.3201 WP_001107167.1.32024 WP_001107167.1.32037 WP_001107167.1.32063 WP_001107167.1.32093 WP_001107167.1.32121 WP_001107167.1.32142 WP_001107167.1.32184 WP_001107167.1.322 WP_001107167.1.32222 WP_001107167.1.32232 WP_001107167.1.32243 WP_001107167.1.32287 WP_001107167.1.3233 WP_001107167.1.32394 WP_001107167.1.32406 WP_001107167.1.3247 WP_001107167.1.32475 WP_001107167.1.32478 WP_001107167.1.32479 WP_001107167.1.3248 WP_001107167.1.32480 WP_001107167.1.32494 WP_001107167.1.32509 WP_001107167.1.32518 WP_001107167.1.32536 WP_001107167.1.32558 WP_001107167.1.32574 WP_001107167.1.32590 WP_001107167.1.32591 WP_001107167.1.32601 WP_001107167.1.32650 WP_001107167.1.32661 WP_001107167.1.32676 WP_001107167.1.32718 WP_001107167.1.32722 WP_001107167.1.32748 WP_001107167.1.32772 WP_001107167.1.32811 WP_001107167.1.32815 WP_001107167.1.32831 WP_001107167.1.32888 WP_001107167.1.32903 WP_001107167.1.32910 WP_001107167.1.32931 WP_001107167.1.32938 WP_001107167.1.3295 WP_001107167.1.32984 WP_001107167.1.32995 WP_001107167.1.33004 WP_001107167.1.33022 WP_001107167.1.33046 WP_001107167.1.33049 WP_001107167.1.33055 WP_001107167.1.33094 WP_001107167.1.33119 WP_001107167.1.33125 WP_001107167.1.33146 WP_001107167.1.33167 WP_001107167.1.33178 WP_001107167.1.33190 WP_001107167.1.33217 WP_001107167.1.33222 WP_001107167.1.33244 WP_001107167.1.33268 WP_001107167.1.33352 WP_001107167.1.33385 WP_001107167.1.334 WP_001107167.1.33422 WP_001107167.1.33424 WP_001107167.1.33428 WP_001107167.1.33475 WP_001107167.1.33526 WP_001107167.1.3354 WP_001107167.1.33545 WP_001107167.1.33565 WP_001107167.1.33584 WP_001107167.1.33631 WP_001107167.1.33638 WP_001107167.1.33648 WP_001107167.1.33667 WP_001107167.1.33680 WP_001107167.1.33736 WP_001107167.1.33751 WP_001107167.1.33799 WP_001107167.1.33823 WP_001107167.1.33853 WP_001107167.1.33879 WP_001107167.1.33914 WP_001107167.1.33948 WP_001107167.1.33952 WP_001107167.1.33973 WP_001107167.1.33974 WP_001107167.1.3398 WP_001107167.1.33981 WP_001107167.1.3401 WP_001107167.1.34032 WP_001107167.1.34117 WP_001107167.1.34122 WP_001107167.1.34124 WP_001107167.1.342 WP_001107167.1.34204 WP_001107167.1.34206 WP_001107167.1.34208 WP_001107167.1.34224 WP_001107167.1.34269 WP_001107167.1.34277 WP_001107167.1.34303 WP_001107167.1.3432 WP_001107167.1.34332 WP_001107167.1.34341 WP_001107167.1.34362 WP_001107167.1.34363 WP_001107167.1.34383 WP_001107167.1.3439 WP_001107167.1.34444 WP_001107167.1.34456 WP_001107167.1.34464 WP_001107167.1.34500 WP_001107167.1.34525 WP_001107167.1.34532 WP_001107167.1.34538 WP_001107167.1.34605 WP_001107167.1.34680 WP_001107167.1.34683 WP_001107167.1.34686 WP_001107167.1.347 WP_001107167.1.3472 WP_001107167.1.34727 WP_001107167.1.34781 WP_001107167.1.34782 WP_001107167.1.34794 WP_001107167.1.34835 WP_001107167.1.34913 WP_001107167.1.34948 WP_001107167.1.34966 WP_001107167.1.34982 WP_001107167.1.34990 WP_001107167.1.34993 WP_001107167.1.35003 WP_001107167.1.35012 WP_001107167.1.35107 WP_001107167.1.35195 WP_001107167.1.35204 WP_001107167.1.35211 WP_001107167.1.35220 WP_001107167.1.35253 WP_001107167.1.35316 WP_001107167.1.35328 WP_001107167.1.35360 WP_001107167.1.35365 WP_001107167.1.35376 WP_001107167.1.3539 WP_001107167.1.35393 WP_001107167.1.35394 WP_001107167.1.35464 WP_001107167.1.35468 WP_001107167.1.35483 WP_001107167.1.3550 WP_001107167.1.35578 WP_001107167.1.35581 WP_001107167.1.3560 WP_001107167.1.35651 WP_001107167.1.35653 WP_001107167.1.35704 WP_001107167.1.35740 WP_001107167.1.35741 WP_001107167.1.35744 WP_001107167.1.35789 WP_001107167.1.35889 WP_001107167.1.35904 WP_001107167.1.35922 WP_001107167.1.35927 WP_001107167.1.35934 WP_001107167.1.35959 WP_001107167.1.35990 WP_001107167.1.3600 WP_001107167.1.36010 WP_001107167.1.36071 WP_001107167.1.36085 WP_001107167.1.36094 WP_001107167.1.36132 WP_001107167.1.36158 WP_001107167.1.36164 WP_001107167.1.36166 WP_001107167.1.36177 WP_001107167.1.36182 WP_001107167.1.3620 WP_001107167.1.36207 WP_001107167.1.36212 WP_001107167.1.3624 WP_001107167.1.36334 WP_001107167.1.36352 WP_001107167.1.36386 WP_001107167.1.36414 WP_001107167.1.36453 WP_001107167.1.36459 WP_001107167.1.36496 WP_001107167.1.365 WP_001107167.1.36523 WP_001107167.1.36531 WP_001107167.1.36545 WP_001107167.1.36610 WP_001107167.1.36626 WP_001107167.1.36627 WP_001107167.1.36699 WP_001107167.1.3671 WP_001107167.1.36724 WP_001107167.1.36739 WP_001107167.1.36746 WP_001107167.1.36747 WP_001107167.1.36767 WP_001107167.1.36799 WP_001107167.1.36806 WP_001107167.1.36817 WP_001107167.1.36826 WP_001107167.1.36856 WP_001107167.1.36904 WP_001107167.1.37020 WP_001107167.1.37032 WP_001107167.1.37046 WP_001107167.1.37057 WP_001107167.1.37099 WP_001107167.1.37102 WP_001107167.1.37103 WP_001107167.1.37206 WP_001107167.1.3723 WP_001107167.1.37233 WP_001107167.1.37252 WP_001107167.1.37261 WP_001107167.1.37266 WP_001107167.1.37290 WP_001107167.1.37313 WP_001107167.1.37329 WP_001107167.1.37337 WP_001107167.1.37360 WP_001107167.1.37372 WP_001107167.1.37388 WP_001107167.1.37433 WP_001107167.1.37445 WP_001107167.1.37472 WP_001107167.1.37476 WP_001107167.1.37477 WP_001107167.1.37485 WP_001107167.1.37510 WP_001107167.1.37548 WP_001107167.1.37588 WP_001107167.1.37592 WP_001107167.1.37608 WP_001107167.1.3762 WP_001107167.1.37634 WP_001107167.1.37664 WP_001107167.1.377 WP_001107167.1.3772 WP_001107167.1.37731 WP_001107167.1.37736 WP_001107167.1.37745 WP_001107167.1.37750 WP_001107167.1.37762 WP_001107167.1.37766 WP_001107167.1.37769 WP_001107167.1.3788 WP_001107167.1.37897 WP_001107167.1.37917 WP_001107167.1.3795 WP_001107167.1.3796 WP_001107167.1.37962 WP_001107167.1.37964 WP_001107167.1.37995 WP_001107167.1.38033 WP_001107167.1.38050 WP_001107167.1.38080 WP_001107167.1.38081 WP_001107167.1.38085 WP_001107167.1.38103 WP_001107167.1.38105 WP_001107167.1.38107 WP_001107167.1.3811 WP_001107167.1.3815 WP_001107167.1.38155 WP_001107167.1.38182 WP_001107167.1.38185 WP_001107167.1.38194 WP_001107167.1.38211 WP_001107167.1.38234 WP_001107167.1.38293 WP_001107167.1.38306 WP_001107167.1.38314 WP_001107167.1.38363 WP_001107167.1.38369 WP_001107167.1.38392 WP_001107167.1.38412 WP_001107167.1.38485 WP_001107167.1.38533 WP_001107167.1.38544 WP_001107167.1.38567 WP_001107167.1.38584 WP_001107167.1.38626 WP_001107167.1.38629 WP_001107167.1.38636 WP_001107167.1.38694 WP_001107167.1.38722 WP_001107167.1.3873 WP_001107167.1.38751 WP_001107167.1.38782 WP_001107167.1.38835 WP_001107167.1.38896 WP_001107167.1.389 WP_001107167.1.38911 WP_001107167.1.38920 WP_001107167.1.38950 WP_001107167.1.38956 WP_001107167.1.38958 WP_001107167.1.39005 WP_001107167.1.3904 WP_001107167.1.39042 WP_001107167.1.39103 WP_001107167.1.39123 WP_001107167.1.39148 WP_001107167.1.39150 WP_001107167.1.39164 WP_001107167.1.39167 WP_001107167.1.39180 WP_001107167.1.39196 WP_001107167.1.39209 WP_001107167.1.39249 WP_001107167.1.39254 WP_001107167.1.39268 WP_001107167.1.39305 WP_001107167.1.39310 WP_001107167.1.39313 WP_001107167.1.39327 WP_001107167.1.39335 WP_001107167.1.39342 WP_001107167.1.39356 WP_001107167.1.39365 WP_001107167.1.39367 WP_001107167.1.39415 WP_001107167.1.39423 WP_001107167.1.39430 WP_001107167.1.39531 WP_001107167.1.39541 WP_001107167.1.39564 WP_001107167.1.39575 WP_001107167.1.39594 WP_001107167.1.39601 WP_001107167.1.39606 WP_001107167.1.39626 WP_001107167.1.39636 WP_001107167.1.39646 WP_001107167.1.39651 WP_001107167.1.3970 WP_001107167.1.39717 WP_001107167.1.39726 WP_001107167.1.39733 WP_001107167.1.39734 WP_001107167.1.39780 WP_001107167.1.39796 WP_001107167.1.3980 WP_001107167.1.39820 WP_001107167.1.39822 WP_001107167.1.39829 WP_001107167.1.39870 WP_001107167.1.39938 WP_001107167.1.39970 WP_001107167.1.39992 WP_001107167.1.39998 WP_001107167.1.40 WP_001107167.1.40013 WP_001107167.1.40019 WP_001107167.1.40083 WP_001107167.1.40088 WP_001107167.1.40113 WP_001107167.1.40140 WP_001107167.1.40147 WP_001107167.1.40153 WP_001107167.1.40192 WP_001107167.1.40206 WP_001107167.1.40211 WP_001107167.1.40218 WP_001107167.1.40234 WP_001107167.1.40238 WP_001107167.1.40249 WP_001107167.1.40298 WP_001107167.1.4030 WP_001107167.1.40317 WP_001107167.1.40319 WP_001107167.1.40335 WP_001107167.1.40349 WP_001107167.1.40382 WP_001107167.1.40389 WP_001107167.1.40391 WP_001107167.1.40445 WP_001107167.1.40486 WP_001107167.1.40502 WP_001107167.1.40548 WP_001107167.1.40549 WP_001107167.1.40563 WP_001107167.1.40617 WP_001107167.1.40629 WP_001107167.1.40666 WP_001107167.1.40712 WP_001107167.1.40742 WP_001107167.1.40758 WP_001107167.1.40781 WP_001107167.1.40793 WP_001107167.1.40813 WP_001107167.1.4082 WP_001107167.1.40833 WP_001107167.1.40842 WP_001107167.1.40843 WP_001107167.1.40882 WP_001107167.1.40898 WP_001107167.1.40900 WP_001107167.1.40912 WP_001107167.1.40937 WP_001107167.1.40952 WP_001107167.1.40965 WP_001107167.1.4103 WP_001107167.1.41037 WP_001107167.1.41041 WP_001107167.1.41060 WP_001107167.1.41063 WP_001107167.1.41078 WP_001107167.1.41113 WP_001107167.1.41125 WP_001107167.1.41147 WP_001107167.1.4122 WP_001107167.1.41263 WP_001107167.1.41287 WP_001107167.1.41294 WP_001107167.1.41315 WP_001107167.1.41330 WP_001107167.1.41332 WP_001107167.1.41346 WP_001107167.1.41363 WP_001107167.1.41368 WP_001107167.1.41392 WP_001107167.1.41394 WP_001107167.1.41401 WP_001107167.1.41407 WP_001107167.1.41417 WP_001107167.1.41455 WP_001107167.1.41466 WP_001107167.1.41478 WP_001107167.1.41484 WP_001107167.1.41488 WP_001107167.1.41536 WP_001107167.1.41545 WP_001107167.1.41556 WP_001107167.1.4158 WP_001107167.1.41613 WP_001107167.1.41621 WP_001107167.1.41651 WP_001107167.1.41654 WP_001107167.1.41712 WP_001107167.1.4172 WP_001107167.1.41734 WP_001107167.1.41741 WP_001107167.1.41782 WP_001107167.1.41784 WP_001107167.1.41812 WP_001107167.1.41813 WP_001107167.1.41826 WP_001107167.1.41847 WP_001107167.1.41849 WP_001107167.1.41884 WP_001107167.1.41885 WP_001107167.1.4189 WP_001107167.1.41900 WP_001107167.1.41923 WP_001107167.1.41956 WP_001107167.1.41991 WP_001107167.1.42022 WP_001107167.1.42033 WP_001107167.1.42036 WP_001107167.1.42038 WP_001107167.1.42060 WP_001107167.1.42073 WP_001107167.1.42113 WP_001107167.1.4213 WP_001107167.1.42138 WP_001107167.1.42159 WP_001107167.1.42179 WP_001107167.1.42203 WP_001107167.1.42209 WP_001107167.1.42214 WP_001107167.1.42228 WP_001107167.1.42233 WP_001107167.1.4224 WP_001107167.1.42252 WP_001107167.1.42318 WP_001107167.1.42350 WP_001107167.1.42367 WP_001107167.1.42376 WP_001107167.1.42387 WP_001107167.1.42413 WP_001107167.1.4242 WP_001107167.1.42432 WP_001107167.1.42442 WP_001107167.1.42447 WP_001107167.1.42480 WP_001107167.1.4250 WP_001107167.1.42513 WP_001107167.1.42516 WP_001107167.1.42522 WP_001107167.1.42586 WP_001107167.1.42594 WP_001107167.1.42600 WP_001107167.1.4261 WP_001107167.1.42632 WP_001107167.1.42661 WP_001107167.1.42669 WP_001107167.1.42670 WP_001107167.1.42677 WP_001107167.1.42748 WP_001107167.1.42749 WP_001107167.1.42756 WP_001107167.1.42770 WP_001107167.1.42771 WP_001107167.1.42804 WP_001107167.1.42808 WP_001107167.1.4282 WP_001107167.1.42832 WP_001107167.1.42863 WP_001107167.1.42879 WP_001107167.1.4290 WP_001107167.1.42918 WP_001107167.1.42936 WP_001107167.1.42937 WP_001107167.1.42950 WP_001107167.1.42975 WP_001107167.1.42987 WP_001107167.1.42989 WP_001107167.1.42991 WP_001107167.1.43013 WP_001107167.1.43027 WP_001107167.1.43035 WP_001107167.1.4306 WP_001107167.1.43079 WP_001107167.1.43121 WP_001107167.1.4313 WP_001107167.1.43132 WP_001107167.1.43140 WP_001107167.1.43166 WP_001107167.1.43174 WP_001107167.1.43196 WP_001107167.1.43216 WP_001107167.1.43239 WP_001107167.1.43270 WP_001107167.1.43316 WP_001107167.1.4334 WP_001107167.1.43384 WP_001107167.1.4342 WP_001107167.1.43422 WP_001107167.1.43427 WP_001107167.1.43444 WP_001107167.1.43448 WP_001107167.1.43455 WP_001107167.1.43469 WP_001107167.1.43473 WP_001107167.1.43474 WP_001107167.1.43489 WP_001107167.1.43501 WP_001107167.1.43536 WP_001107167.1.4356 WP_001107167.1.43598 WP_001107167.1.43604 WP_001107167.1.43622 WP_001107167.1.43642 WP_001107167.1.43720 WP_001107167.1.43733 WP_001107167.1.43738 WP_001107167.1.43750 WP_001107167.1.43754 WP_001107167.1.43798 WP_001107167.1.43803 WP_001107167.1.43804 WP_001107167.1.43816 WP_001107167.1.43837 WP_001107167.1.43868 WP_001107167.1.43898 WP_001107167.1.43911 WP_001107167.1.43918 WP_001107167.1.43925 WP_001107167.1.43939 WP_001107167.1.43942 WP_001107167.1.43953 WP_001107167.1.43966 WP_001107167.1.43989 WP_001107167.1.440 WP_001107167.1.44018 WP_001107167.1.44020 WP_001107167.1.44040 WP_001107167.1.44077 WP_001107167.1.44096 WP_001107167.1.44100 WP_001107167.1.44115 WP_001107167.1.44125 WP_001107167.1.44130 WP_001107167.1.4415 WP_001107167.1.44162 WP_001107167.1.44165 WP_001107167.1.44166 WP_001107167.1.44203 WP_001107167.1.44211 WP_001107167.1.44238 WP_001107167.1.44251 WP_001107167.1.44273 WP_001107167.1.44285 WP_001107167.1.44292 WP_001107167.1.44324 WP_001107167.1.44327 WP_001107167.1.44354 WP_001107167.1.44365 WP_001107167.1.44389 WP_001107167.1.44394 WP_001107167.1.44422 WP_001107167.1.44445 WP_001107167.1.44447 WP_001107167.1.44458 WP_001107167.1.44460 WP_001107167.1.44461 WP_001107167.1.44488 WP_001107167.1.44524 WP_001107167.1.44558 WP_001107167.1.44561 WP_001107167.1.44570 WP_001107167.1.44587 WP_001107167.1.4459 WP_001107167.1.44608 WP_001107167.1.44610 WP_001107167.1.44622 WP_001107167.1.4463 WP_001107167.1.44642 WP_001107167.1.44649 WP_001107167.1.44668 WP_001107167.1.44717 WP_001107167.1.44724 WP_001107167.1.44733 WP_001107167.1.44756 WP_001107167.1.44759 WP_001107167.1.44784 WP_001107167.1.44800 WP_001107167.1.44821 WP_001107167.1.44841 WP_001107167.1.44843 WP_001107167.1.44849 WP_001107167.1.44857 WP_001107167.1.44906 WP_001107167.1.44923 WP_001107167.1.44954 WP_001107167.1.44961 WP_001107167.1.44970 WP_001107167.1.44975 WP_001107167.1.45020 WP_001107167.1.45025 WP_001107167.1.45028 WP_001107167.1.45043 WP_001107167.1.45076 WP_001107167.1.45116 WP_001107167.1.45153 WP_001107167.1.45190 WP_001107167.1.45195 WP_001107167.1.45208 WP_001107167.1.45293 WP_001107167.1.4530 WP_001107167.1.45301 WP_001107167.1.45313 WP_001107167.1.45329 WP_001107167.1.45404 WP_001107167.1.4541 WP_001107167.1.45440 WP_001107167.1.4549 WP_001107167.1.45525 WP_001107167.1.45536 WP_001107167.1.45565 WP_001107167.1.45575 WP_001107167.1.45595 WP_001107167.1.45600 WP_001107167.1.45674 WP_001107167.1.45707 WP_001107167.1.4574 WP_001107167.1.45741 WP_001107167.1.45752 WP_001107167.1.45789 WP_001107167.1.45801 WP_001107167.1.45806 WP_001107167.1.45840 WP_001107167.1.45841 WP_001107167.1.45846 WP_001107167.1.45865 WP_001107167.1.45868 WP_001107167.1.45891 WP_001107167.1.45901 WP_001107167.1.45921 WP_001107167.1.4593 WP_001107167.1.45930 WP_001107167.1.45931 WP_001107167.1.45933 WP_001107167.1.45941 WP_001107167.1.45945 WP_001107167.1.45960 WP_001107167.1.45990 WP_001107167.1.4600 WP_001107167.1.46016 WP_001107167.1.46026 WP_001107167.1.46027 WP_001107167.1.46039 WP_001107167.1.46048 WP_001107167.1.46081 WP_001107167.1.46097 WP_001107167.1.4610 WP_001107167.1.46105 WP_001107167.1.46115 WP_001107167.1.46122 WP_001107167.1.4613 WP_001107167.1.46186 WP_001107167.1.4619 WP_001107167.1.46239 WP_001107167.1.46257 WP_001107167.1.46263 WP_001107167.1.46282 WP_001107167.1.46283 WP_001107167.1.46325 WP_001107167.1.46329 WP_001107167.1.46369 WP_001107167.1.46378 WP_001107167.1.46414 WP_001107167.1.46433 WP_001107167.1.46438 WP_001107167.1.46451 WP_001107167.1.4647 WP_001107167.1.46503 WP_001107167.1.46555 WP_001107167.1.46573 WP_001107167.1.46582 WP_001107167.1.46597 WP_001107167.1.46611 WP_001107167.1.46626 WP_001107167.1.46668 WP_001107167.1.4670 WP_001107167.1.46743 WP_001107167.1.46795 WP_001107167.1.46798 WP_001107167.1.46802 WP_001107167.1.46810 WP_001107167.1.46820 WP_001107167.1.46821 WP_001107167.1.46832 WP_001107167.1.46833 WP_001107167.1.46841 WP_001107167.1.46882 WP_001107167.1.46913 WP_001107167.1.46932 WP_001107167.1.4695 WP_001107167.1.46990 WP_001107167.1.46994 WP_001107167.1.47024 WP_001107167.1.47028 WP_001107167.1.47034 WP_001107167.1.47039 WP_001107167.1.47048 WP_001107167.1.47054 WP_001107167.1.47063 WP_001107167.1.4708 WP_001107167.1.47124 WP_001107167.1.47140 WP_001107167.1.47156 WP_001107167.1.47167 WP_001107167.1.47186 WP_001107167.1.47189 WP_001107167.1.47197 WP_001107167.1.4722 WP_001107167.1.47224 WP_001107167.1.4723 WP_001107167.1.47235 WP_001107167.1.47246 WP_001107167.1.47307 WP_001107167.1.47319 WP_001107167.1.47322 WP_001107167.1.47332 WP_001107167.1.47344 WP_001107167.1.47349 WP_001107167.1.47366 WP_001107167.1.47370 WP_001107167.1.47386 WP_001107167.1.47398 WP_001107167.1.47401 WP_001107167.1.47411 WP_001107167.1.47414 WP_001107167.1.4743 WP_001107167.1.47454 WP_001107167.1.47464 WP_001107167.1.47473 WP_001107167.1.47477 WP_001107167.1.47498 WP_001107167.1.47500 WP_001107167.1.47555 WP_001107167.1.47634 WP_001107167.1.47646 WP_001107167.1.47654 WP_001107167.1.47662 WP_001107167.1.47673 WP_001107167.1.47709 WP_001107167.1.4772 WP_001107167.1.47740 WP_001107167.1.47744 WP_001107167.1.47761 WP_001107167.1.47764 WP_001107167.1.47765 WP_001107167.1.47770 WP_001107167.1.47784 WP_001107167.1.47791 WP_001107167.1.47820 WP_001107167.1.47827 WP_001107167.1.47848 WP_001107167.1.47884 WP_001107167.1.47954 WP_001107167.1.47962 WP_001107167.1.47976 WP_001107167.1.47994 WP_001107167.1.48040 WP_001107167.1.48048 WP_001107167.1.48065 WP_001107167.1.48073 WP_001107167.1.48077 WP_001107167.1.48080 WP_001107167.1.48090 WP_001107167.1.48096 WP_001107167.1.4811 WP_001107167.1.48111 WP_001107167.1.4812 WP_001107167.1.48121 WP_001107167.1.48144 WP_001107167.1.48168 WP_001107167.1.48176 WP_001107167.1.48194 WP_001107167.1.48203 WP_001107167.1.48216 WP_001107167.1.48222 WP_001107167.1.48226 WP_001107167.1.48258 WP_001107167.1.48265 WP_001107167.1.48290 WP_001107167.1.48291 WP_001107167.1.48353 WP_001107167.1.48371 WP_001107167.1.48431 WP_001107167.1.48433 WP_001107167.1.48477 WP_001107167.1.48480 WP_001107167.1.48483 WP_001107167.1.48505 WP_001107167.1.48522 WP_001107167.1.48571 WP_001107167.1.486 WP_001107167.1.48615 WP_001107167.1.48620 WP_001107167.1.48629 WP_001107167.1.48697 WP_001107167.1.4871 WP_001107167.1.48712 WP_001107167.1.4876 WP_001107167.1.48792 WP_001107167.1.48801 WP_001107167.1.48806 WP_001107167.1.48808 WP_001107167.1.48847 WP_001107167.1.48860 WP_001107167.1.48910 WP_001107167.1.48921 WP_001107167.1.48926 WP_001107167.1.48953 WP_001107167.1.48954 WP_001107167.1.48970 WP_001107167.1.48974 WP_001107167.1.49009 WP_001107167.1.49061 WP_001107167.1.49076 WP_001107167.1.49107 WP_001107167.1.49147 WP_001107167.1.49170 WP_001107167.1.49179 WP_001107167.1.49190 WP_001107167.1.49229 WP_001107167.1.49236 WP_001107167.1.49258 WP_001107167.1.49275 WP_001107167.1.4931 WP_001107167.1.49332 WP_001107167.1.49336 WP_001107167.1.49363 WP_001107167.1.49401 WP_001107167.1.49412 WP_001107167.1.49446 WP_001107167.1.49464 WP_001107167.1.49481 WP_001107167.1.49482 WP_001107167.1.49483 WP_001107167.1.4949 WP_001107167.1.49496 WP_001107167.1.49522 WP_001107167.1.49531 WP_001107167.1.49537 WP_001107167.1.49546 WP_001107167.1.49558 WP_001107167.1.49567 WP_001107167.1.49645 WP_001107167.1.49655 WP_001107167.1.49661 WP_001107167.1.49662 WP_001107167.1.49675 WP_001107167.1.497 WP_001107167.1.49712 WP_001107167.1.49722 WP_001107167.1.49733 WP_001107167.1.49740 WP_001107167.1.49768 WP_001107167.1.49771 WP_001107167.1.49788 WP_001107167.1.49794 WP_001107167.1.49820 WP_001107167.1.4985 WP_001107167.1.49856 WP_001107167.1.49879 WP_001107167.1.49883 WP_001107167.1.49900 WP_001107167.1.49941 WP_001107167.1.49950 WP_001107167.1.49987 WP_001107167.1.50006 WP_001107167.1.50008 WP_001107167.1.5003 WP_001107167.1.50036 WP_001107167.1.50056 WP_001107167.1.50078 WP_001107167.1.50110 WP_001107167.1.50119 WP_001107167.1.50179 WP_001107167.1.50182 WP_001107167.1.50187 WP_001107167.1.50191 WP_001107167.1.50207 WP_001107167.1.50214 WP_001107167.1.50228 WP_001107167.1.50258 WP_001107167.1.50262 WP_001107167.1.50266 WP_001107167.1.50278 WP_001107167.1.50345 WP_001107167.1.50353 WP_001107167.1.50358 WP_001107167.1.50361 WP_001107167.1.5037 WP_001107167.1.50380 WP_001107167.1.50412 WP_001107167.1.50427 WP_001107167.1.50452 WP_001107167.1.50549 WP_001107167.1.5056 WP_001107167.1.50564 WP_001107167.1.50579 WP_001107167.1.50608 WP_001107167.1.50627 WP_001107167.1.5064 WP_001107167.1.5067 WP_001107167.1.50700 WP_001107167.1.50717 WP_001107167.1.50762 WP_001107167.1.50887 WP_001107167.1.50947 WP_001107167.1.5095 WP_001107167.1.50957 WP_001107167.1.50986 WP_001107167.1.51027 WP_001107167.1.51042 WP_001107167.1.5106 WP_001107167.1.511 WP_001107167.1.51109 WP_001107167.1.51154 WP_001107167.1.51171 WP_001107167.1.51172 WP_001107167.1.51175 WP_001107167.1.51203 WP_001107167.1.51255 WP_001107167.1.51260 WP_001107167.1.51278 WP_001107167.1.5128 WP_001107167.1.51283 WP_001107167.1.51299 WP_001107167.1.51300 WP_001107167.1.51325 WP_001107167.1.51330 WP_001107167.1.51380 WP_001107167.1.51405 WP_001107167.1.51425 WP_001107167.1.51426 WP_001107167.1.51427 WP_001107167.1.51441 WP_001107167.1.5146 WP_001107167.1.51490 WP_001107167.1.51495 WP_001107167.1.51505 WP_001107167.1.51525 WP_001107167.1.51537 WP_001107167.1.51539 WP_001107167.1.51548 WP_001107167.1.51552 WP_001107167.1.5158 WP_001107167.1.51587 WP_001107167.1.51607 WP_001107167.1.51643 WP_001107167.1.51690 WP_001107167.1.51693 WP_001107167.1.51757 WP_001107167.1.51760 WP_001107167.1.51784 WP_001107167.1.518 WP_001107167.1.51804 WP_001107167.1.51834 WP_001107167.1.51839 WP_001107167.1.51873 WP_001107167.1.51896 WP_001107167.1.51944 WP_001107167.1.51949 WP_001107167.1.51968 WP_001107167.1.51985 WP_001107167.1.51988 WP_001107167.1.5199 WP_001107167.1.52002 WP_001107167.1.52020 WP_001107167.1.52039 WP_001107167.1.52085 WP_001107167.1.52135 WP_001107167.1.52137 WP_001107167.1.5217 WP_001107167.1.52200 WP_001107167.1.52211 WP_001107167.1.52214 WP_001107167.1.52249 WP_001107167.1.52270 WP_001107167.1.52272 WP_001107167.1.52299 WP_001107167.1.52305 WP_001107167.1.52313 WP_001107167.1.52333 WP_001107167.1.52363 WP_001107167.1.52378 WP_001107167.1.52399 WP_001107167.1.52419 WP_001107167.1.52421 WP_001107167.1.52496 WP_001107167.1.52542 WP_001107167.1.52543 WP_001107167.1.52544 WP_001107167.1.52558 WP_001107167.1.52568 WP_001107167.1.5265 WP_001107167.1.52662 WP_001107167.1.52710 WP_001107167.1.5272 WP_001107167.1.52735 WP_001107167.1.52762 WP_001107167.1.52771 WP_001107167.1.52774 WP_001107167.1.52777 WP_001107167.1.52780 WP_001107167.1.52801 WP_001107167.1.52844 WP_001107167.1.52846 WP_001107167.1.5285 WP_001107167.1.52852 WP_001107167.1.52853 WP_001107167.1.52883 WP_001107167.1.52895 WP_001107167.1.52908 WP_001107167.1.52933 WP_001107167.1.52945 WP_001107167.1.53012 WP_001107167.1.53020 WP_001107167.1.53021 WP_001107167.1.53027 WP_001107167.1.53065 WP_001107167.1.53084 WP_001107167.1.53095 WP_001107167.1.5310 WP_001107167.1.53110 WP_001107167.1.53123 WP_001107167.1.53155 WP_001107167.1.53181 WP_001107167.1.53211 WP_001107167.1.53238 WP_001107167.1.53244 WP_001107167.1.53251 WP_001107167.1.53252 WP_001107167.1.53270 WP_001107167.1.53327 WP_001107167.1.53360 WP_001107167.1.53364 WP_001107167.1.53377 WP_001107167.1.53401 WP_001107167.1.53410 WP_001107167.1.53428 WP_001107167.1.53482 WP_001107167.1.53505 WP_001107167.1.53537 WP_001107167.1.53545 WP_001107167.1.53557 WP_001107167.1.53587 WP_001107167.1.53592 WP_001107167.1.53594 WP_001107167.1.5362 WP_001107167.1.53642 WP_001107167.1.53645 WP_001107167.1.53649 WP_001107167.1.53687 WP_001107167.1.53690 WP_001107167.1.53769 WP_001107167.1.53809 WP_001107167.1.53866 WP_001107167.1.53884 WP_001107167.1.53931 WP_001107167.1.53966 WP_001107167.1.53972 WP_001107167.1.53991 WP_001107167.1.54002 WP_001107167.1.54013 WP_001107167.1.54024 WP_001107167.1.54028 WP_001107167.1.54051 WP_001107167.1.54072 WP_001107167.1.54091 WP_001107167.1.54102 WP_001107167.1.54104 WP_001107167.1.54144 WP_001107167.1.54169 WP_001107167.1.54185 WP_001107167.1.54188 WP_001107167.1.54202 WP_001107167.1.54208 WP_001107167.1.54213 WP_001107167.1.54263 WP_001107167.1.54313 WP_001107167.1.54329 WP_001107167.1.5434 WP_001107167.1.54344 WP_001107167.1.54359 WP_001107167.1.54388 WP_001107167.1.54394 WP_001107167.1.5441 WP_001107167.1.54417 WP_001107167.1.54429 WP_001107167.1.54454 WP_001107167.1.54463 WP_001107167.1.54476 WP_001107167.1.54534 WP_001107167.1.54590 WP_001107167.1.54605 WP_001107167.1.54617 WP_001107167.1.54620 WP_001107167.1.54638 WP_001107167.1.5467 WP_001107167.1.54688 WP_001107167.1.54708 WP_001107167.1.54725 WP_001107167.1.54729 WP_001107167.1.54754 WP_001107167.1.54769 WP_001107167.1.5478 WP_001107167.1.5479 WP_001107167.1.54875 WP_001107167.1.54883 WP_001107167.1.54927 WP_001107167.1.54940 WP_001107167.1.54941 WP_001107167.1.54981 WP_001107167.1.54991 WP_001107167.1.54993 WP_001107167.1.55003 WP_001107167.1.55005 WP_001107167.1.55009 WP_001107167.1.55041 WP_001107167.1.55112 WP_001107167.1.5512 WP_001107167.1.55123 WP_001107167.1.55134 WP_001107167.1.55144 WP_001107167.1.55179 WP_001107167.1.5520 WP_001107167.1.55218 WP_001107167.1.55226 WP_001107167.1.55273 WP_001107167.1.55275 WP_001107167.1.55286 WP_001107167.1.55357 WP_001107167.1.55359 WP_001107167.1.55374 WP_001107167.1.55381 WP_001107167.1.55420 WP_001107167.1.55424 WP_001107167.1.55425 WP_001107167.1.55466 WP_001107167.1.55489 WP_001107167.1.55492 WP_001107167.1.55507 WP_001107167.1.55529 WP_001107167.1.55550 WP_001107167.1.55552 WP_001107167.1.55556 WP_001107167.1.55560 WP_001107167.1.55563 WP_001107167.1.55571 WP_001107167.1.55574 WP_001107167.1.55608 WP_001107167.1.55676 WP_001107167.1.55709 WP_001107167.1.55720 WP_001107167.1.55730 WP_001107167.1.55731 WP_001107167.1.55744 WP_001107167.1.55757 WP_001107167.1.55790 WP_001107167.1.55791 WP_001107167.1.55808 WP_001107167.1.55820 WP_001107167.1.55825 WP_001107167.1.55838 WP_001107167.1.55844 WP_001107167.1.55868 WP_001107167.1.55888 WP_001107167.1.55892 WP_001107167.1.55896 WP_001107167.1.55897 WP_001107167.1.55988 WP_001107167.1.55990 WP_001107167.1.56072 WP_001107167.1.561 WP_001107167.1.56122 WP_001107167.1.5614 WP_001107167.1.56151 WP_001107167.1.5616 WP_001107167.1.56164 WP_001107167.1.56197 WP_001107167.1.562 WP_001107167.1.56216 WP_001107167.1.56231 WP_001107167.1.56285 WP_001107167.1.56302 WP_001107167.1.56371 WP_001107167.1.5639 WP_001107167.1.56392 WP_001107167.1.56399 WP_001107167.1.56436 WP_001107167.1.56439 WP_001107167.1.5646 WP_001107167.1.56469 WP_001107167.1.56481 WP_001107167.1.56489 WP_001107167.1.56491 WP_001107167.1.56501 WP_001107167.1.56502 WP_001107167.1.56513 WP_001107167.1.56523 WP_001107167.1.56528 WP_001107167.1.56543 WP_001107167.1.56554 WP_001107167.1.56571 WP_001107167.1.56586 WP_001107167.1.56650 WP_001107167.1.56662 WP_001107167.1.56680 WP_001107167.1.5670 WP_001107167.1.56704 WP_001107167.1.56721 WP_001107167.1.56786 WP_001107167.1.56789 WP_001107167.1.56830 WP_001107167.1.56835 WP_001107167.1.56846 WP_001107167.1.56871 WP_001107167.1.56882 WP_001107167.1.56932 WP_001107167.1.56934 WP_001107167.1.56941 WP_001107167.1.56978 WP_001107167.1.56980 WP_001107167.1.57032 WP_001107167.1.57045 WP_001107167.1.57068 WP_001107167.1.57071 WP_001107167.1.57072 WP_001107167.1.57079 WP_001107167.1.57124 WP_001107167.1.57180 WP_001107167.1.57181 WP_001107167.1.57197 WP_001107167.1.57216 WP_001107167.1.57222 WP_001107167.1.57266 WP_001107167.1.57280 WP_001107167.1.57386 WP_001107167.1.57401 WP_001107167.1.57403 WP_001107167.1.57410 WP_001107167.1.57414 WP_001107167.1.57432 WP_001107167.1.57438 WP_001107167.1.57453 WP_001107167.1.57466 WP_001107167.1.5748 WP_001107167.1.57492 WP_001107167.1.57517 WP_001107167.1.57538 WP_001107167.1.57539 WP_001107167.1.57550 WP_001107167.1.57558 WP_001107167.1.57608 WP_001107167.1.57610 WP_001107167.1.57629 WP_001107167.1.5764 WP_001107167.1.57646 WP_001107167.1.57659 WP_001107167.1.57719 WP_001107167.1.57738 WP_001107167.1.57812 WP_001107167.1.57832 WP_001107167.1.57836 WP_001107167.1.57846 WP_001107167.1.57854 WP_001107167.1.5786 WP_001107167.1.57904 WP_001107167.1.57920 WP_001107167.1.57982 WP_001107167.1.58001 WP_001107167.1.58009 WP_001107167.1.58022 WP_001107167.1.58038 WP_001107167.1.58045 WP_001107167.1.58048 WP_001107167.1.58057 WP_001107167.1.58060 WP_001107167.1.58080 WP_001107167.1.58107 WP_001107167.1.58128 WP_001107167.1.58146 WP_001107167.1.58163 WP_001107167.1.58169 WP_001107167.1.58172 WP_001107167.1.58226 WP_001107167.1.58232 WP_001107167.1.58233 WP_001107167.1.58238 WP_001107167.1.58244 WP_001107167.1.58267 WP_001107167.1.58289 WP_001107167.1.58292 WP_001107167.1.58316 WP_001107167.1.58340 WP_001107167.1.58345 WP_001107167.1.58371 WP_001107167.1.58384 WP_001107167.1.584 WP_001107167.1.58401 WP_001107167.1.58414 WP_001107167.1.5842 WP_001107167.1.58420 WP_001107167.1.58423 WP_001107167.1.58424 WP_001107167.1.58429 WP_001107167.1.58444 WP_001107167.1.58459 WP_001107167.1.58475 WP_001107167.1.58493 WP_001107167.1.58514 WP_001107167.1.5852 WP_001107167.1.58528 WP_001107167.1.58547 WP_001107167.1.58622 WP_001107167.1.58657 WP_001107167.1.58692 WP_001107167.1.58707 WP_001107167.1.58723 WP_001107167.1.58737 WP_001107167.1.58837 WP_001107167.1.58870 WP_001107167.1.58940 WP_001107167.1.58951 WP_001107167.1.58958 WP_001107167.1.58976 WP_001107167.1.58977 WP_001107167.1.58983 WP_001107167.1.59024 WP_001107167.1.59026 WP_001107167.1.59035 WP_001107167.1.59038 WP_001107167.1.59047 WP_001107167.1.59060 WP_001107167.1.59119 WP_001107167.1.59190 WP_001107167.1.59199 WP_001107167.1.59263 WP_001107167.1.5927 WP_001107167.1.59291 WP_001107167.1.59292 WP_001107167.1.59293 WP_001107167.1.59302 WP_001107167.1.59306 WP_001107167.1.59359 WP_001107167.1.59374 WP_001107167.1.59395 WP_001107167.1.59425 WP_001107167.1.59470 WP_001107167.1.59483 WP_001107167.1.59491 WP_001107167.1.59513 WP_001107167.1.59533 WP_001107167.1.59553 WP_001107167.1.59577 WP_001107167.1.59579 WP_001107167.1.59613 WP_001107167.1.59615 WP_001107167.1.59621 WP_001107167.1.5963 WP_001107167.1.5965 WP_001107167.1.59679 WP_001107167.1.59714 WP_001107167.1.59730 WP_001107167.1.59733 WP_001107167.1.59756 WP_001107167.1.59781 WP_001107167.1.59782 WP_001107167.1.59788 WP_001107167.1.59815 WP_001107167.1.59823 WP_001107167.1.59838 WP_001107167.1.59858 WP_001107167.1.59877 WP_001107167.1.59894 WP_001107167.1.59905 WP_001107167.1.59912 WP_001107167.1.59931 WP_001107167.1.59959 WP_001107167.1.59970 WP_001107167.1.59981 WP_001107167.1.59989 WP_001107167.1.59998 WP_001107167.1.6002 WP_001107167.1.60023 WP_001107167.1.60031 WP_001107167.1.60042 WP_001107167.1.60043 WP_001107167.1.60048 WP_001107167.1.60067 WP_001107167.1.60070 WP_001107167.1.60096 WP_001107167.1.60110 WP_001107167.1.60117 WP_001107167.1.6013 WP_001107167.1.60151 WP_001107167.1.6022 WP_001107167.1.60228 WP_001107167.1.60304 WP_001107167.1.60337 WP_001107167.1.60343 WP_001107167.1.60350 WP_001107167.1.60374 WP_001107167.1.60411 WP_001107167.1.60461 WP_001107167.1.60477 WP_001107167.1.60498 WP_001107167.1.60505 WP_001107167.1.60550 WP_001107167.1.60567 WP_001107167.1.60576 WP_001107167.1.6059 WP_001107167.1.60591 WP_001107167.1.60606 WP_001107167.1.6061 WP_001107167.1.60613 WP_001107167.1.60630 WP_001107167.1.60647 WP_001107167.1.60654 WP_001107167.1.6066 WP_001107167.1.60698 WP_001107167.1.60717 WP_001107167.1.60744 WP_001107167.1.60761 WP_001107167.1.60764 WP_001107167.1.60805 WP_001107167.1.60835 WP_001107167.1.60872 WP_001107167.1.60895 WP_001107167.1.60901 WP_001107167.1.60927 WP_001107167.1.60935 WP_001107167.1.61005 WP_001107167.1.61035 WP_001107167.1.61039 WP_001107167.1.61046 WP_001107167.1.6106 WP_001107167.1.61096 WP_001107167.1.61097 WP_001107167.1.61099 WP_001107167.1.61102 WP_001107167.1.61108 WP_001107167.1.61112 WP_001107167.1.61170 WP_001107167.1.61181 WP_001107167.1.61183 WP_001107167.1.61186 WP_001107167.1.61241 WP_001107167.1.61253 WP_001107167.1.61284 WP_001107167.1.613 WP_001107167.1.61360 WP_001107167.1.6138 WP_001107167.1.61398 WP_001107167.1.61442 WP_001107167.1.615 WP_001107167.1.61505 WP_001107167.1.61517 WP_001107167.1.61551 WP_001107167.1.61608 WP_001107167.1.61623 WP_001107167.1.61636 WP_001107167.1.61663 WP_001107167.1.61739 WP_001107167.1.61772 WP_001107167.1.618 WP_001107167.1.61806 WP_001107167.1.61822 WP_001107167.1.61835 WP_001107167.1.61874 WP_001107167.1.61948 WP_001107167.1.61949 WP_001107167.1.61957 WP_001107167.1.62038 WP_001107167.1.62041 WP_001107167.1.62043 WP_001107167.1.62091 WP_001107167.1.62099 WP_001107167.1.6212 WP_001107167.1.62135 WP_001107167.1.62157 WP_001107167.1.62182 WP_001107167.1.62207 WP_001107167.1.62236 WP_001107167.1.62262 WP_001107167.1.62296 WP_001107167.1.62322 WP_001107167.1.62337 WP_001107167.1.62358 WP_001107167.1.62460 WP_001107167.1.62480 WP_001107167.1.62481 WP_001107167.1.62487 WP_001107167.1.62503 WP_001107167.1.62514 WP_001107167.1.62529 WP_001107167.1.62555 WP_001107167.1.62586 WP_001107167.1.6261 WP_001107167.1.62646 WP_001107167.1.62668 WP_001107167.1.62675 WP_001107167.1.62681 WP_001107167.1.62735 WP_001107167.1.62780 WP_001107167.1.62787 WP_001107167.1.62812 WP_001107167.1.62818 WP_001107167.1.62819 WP_001107167.1.6282 WP_001107167.1.62840 WP_001107167.1.62843 WP_001107167.1.62851 WP_001107167.1.62866 WP_001107167.1.62885 WP_001107167.1.62888 WP_001107167.1.62919 WP_001107167.1.6293 WP_001107167.1.62951 WP_001107167.1.62973 WP_001107167.1.62989 WP_001107167.1.6299 WP_001107167.1.6307 WP_001107167.1.63078 WP_001107167.1.63113 WP_001107167.1.63167 WP_001107167.1.63177 WP_001107167.1.63189 WP_001107167.1.6323 WP_001107167.1.63246 WP_001107167.1.63271 WP_001107167.1.63287 WP_001107167.1.63305 WP_001107167.1.6331 WP_001107167.1.63310 WP_001107167.1.63330 WP_001107167.1.6337 WP_001107167.1.63370 WP_001107167.1.63374 WP_001107167.1.63393 WP_001107167.1.63419 WP_001107167.1.63433 WP_001107167.1.63437 WP_001107167.1.63445 WP_001107167.1.63453 WP_001107167.1.63465 WP_001107167.1.63466 WP_001107167.1.63467 WP_001107167.1.63470 WP_001107167.1.63478 WP_001107167.1.6348 WP_001107167.1.63484 WP_001107167.1.63487 WP_001107167.1.63491 WP_001107167.1.63536 WP_001107167.1.63563 WP_001107167.1.63586 WP_001107167.1.63615 WP_001107167.1.6364 WP_001107167.1.63666 WP_001107167.1.63703 WP_001107167.1.63721 WP_001107167.1.63746 WP_001107167.1.63810 WP_001107167.1.63814 WP_001107167.1.63872 WP_001107167.1.63957 WP_001107167.1.63964 WP_001107167.1.64014 WP_001107167.1.64030 WP_001107167.1.64040 WP_001107167.1.64045 WP_001107167.1.64050 WP_001107167.1.64074 WP_001107167.1.64080 WP_001107167.1.64086 WP_001107167.1.64110 WP_001107167.1.64138 WP_001107167.1.64150 WP_001107167.1.6416 WP_001107167.1.64161 WP_001107167.1.64165 WP_001107167.1.64175 WP_001107167.1.64180 WP_001107167.1.64190 WP_001107167.1.64285 WP_001107167.1.64286 WP_001107167.1.643 WP_001107167.1.6431 WP_001107167.1.64312 WP_001107167.1.64321 WP_001107167.1.64330 WP_001107167.1.64337 WP_001107167.1.64353 WP_001107167.1.64355 WP_001107167.1.64356 WP_001107167.1.64371 WP_001107167.1.64380 WP_001107167.1.6444 WP_001107167.1.64448 WP_001107167.1.6445 WP_001107167.1.64458 WP_001107167.1.64519 WP_001107167.1.64528 WP_001107167.1.64547 WP_001107167.1.64621 WP_001107167.1.64670 WP_001107167.1.64693 WP_001107167.1.64695 WP_001107167.1.64746 WP_001107167.1.64749 WP_001107167.1.64784 WP_001107167.1.64789 WP_001107167.1.64875 WP_001107167.1.64881 WP_001107167.1.64912 WP_001107167.1.64926 WP_001107167.1.64946 WP_001107167.1.6499 WP_001107167.1.64990 WP_001107167.1.6500 WP_001107167.1.65035 WP_001107167.1.65040 WP_001107167.1.65061 WP_001107167.1.65084 WP_001107167.1.65097 WP_001107167.1.651 WP_001107167.1.65104 WP_001107167.1.6511 WP_001107167.1.65118 WP_001107167.1.65151 WP_001107167.1.65155 WP_001107167.1.65194 WP_001107167.1.65206 WP_001107167.1.65240 WP_001107167.1.65256 WP_001107167.1.65271 WP_001107167.1.65305 WP_001107167.1.65353 WP_001107167.1.65355 WP_001107167.1.65366 WP_001107167.1.6537 WP_001107167.1.65372 WP_001107167.1.65405 WP_001107167.1.65413 WP_001107167.1.65415 WP_001107167.1.65493 WP_001107167.1.65546 WP_001107167.1.65565 WP_001107167.1.65571 WP_001107167.1.65581 WP_001107167.1.65596 WP_001107167.1.6563 WP_001107167.1.65672 WP_001107167.1.65708 WP_001107167.1.6576 WP_001107167.1.65834 WP_001107167.1.6587 WP_001107167.1.65875 WP_001107167.1.65898 WP_001107167.1.65912 WP_001107167.1.65957 WP_001107167.1.65961 WP_001107167.1.65962 WP_001107167.1.65963 WP_001107167.1.65978 WP_001107167.1.65988 WP_001107167.1.6599 WP_001107167.1.66016 WP_001107167.1.66022 WP_001107167.1.66033 WP_001107167.1.6604 WP_001107167.1.66050 WP_001107167.1.66071 WP_001107167.1.66094 WP_001107167.1.66100 WP_001107167.1.66104 WP_001107167.1.66105 WP_001107167.1.66127 WP_001107167.1.66197 WP_001107167.1.66251 WP_001107167.1.66255 WP_001107167.1.66280 WP_001107167.1.66288 WP_001107167.1.66327 WP_001107167.1.66387 WP_001107167.1.66389 WP_001107167.1.66392 WP_001107167.1.66395 WP_001107167.1.66412 WP_001107167.1.66421 WP_001107167.1.6645 WP_001107167.1.66511 WP_001107167.1.66523 WP_001107167.1.66531 WP_001107167.1.6654 WP_001107167.1.66550 WP_001107167.1.66559 WP_001107167.1.66566 WP_001107167.1.66579 WP_001107167.1.66624 WP_001107167.1.6665 WP_001107167.1.6666 WP_001107167.1.66668 WP_001107167.1.66700 WP_001107167.1.66706 WP_001107167.1.66708 WP_001107167.1.66719 WP_001107167.1.66727 WP_001107167.1.66751 WP_001107167.1.66758 WP_001107167.1.66783 WP_001107167.1.66787 WP_001107167.1.66796 WP_001107167.1.66849 WP_001107167.1.66873 WP_001107167.1.66922 WP_001107167.1.66933 WP_001107167.1.66948 WP_001107167.1.66984 WP_001107167.1.67018 WP_001107167.1.67021 WP_001107167.1.67022 WP_001107167.1.67026 WP_001107167.1.67055 WP_001107167.1.6706 WP_001107167.1.67073 WP_001107167.1.67102 WP_001107167.1.67120 WP_001107167.1.67132 WP_001107167.1.67136 WP_001107167.1.67137 WP_001107167.1.67150 WP_001107167.1.67158 WP_001107167.1.67164 WP_001107167.1.67200 WP_001107167.1.67210 WP_001107167.1.67214 WP_001107167.1.6723 WP_001107167.1.67284 WP_001107167.1.67293 WP_001107167.1.6735 WP_001107167.1.67373 WP_001107167.1.67446 WP_001107167.1.67451 WP_001107167.1.67454 WP_001107167.1.67456 WP_001107167.1.67468 WP_001107167.1.67495 WP_001107167.1.67522 WP_001107167.1.67533 WP_001107167.1.67538 WP_001107167.1.67549 WP_001107167.1.67553 WP_001107167.1.67669 WP_001107167.1.67676 WP_001107167.1.67681 WP_001107167.1.67685 WP_001107167.1.6769 WP_001107167.1.67726 WP_001107167.1.67732 WP_001107167.1.67753 WP_001107167.1.67775 WP_001107167.1.67780 WP_001107167.1.67787 WP_001107167.1.67788 WP_001107167.1.67853 WP_001107167.1.67891 WP_001107167.1.67894 WP_001107167.1.6793 WP_001107167.1.67975 WP_001107167.1.67990 WP_001107167.1.67992 WP_001107167.1.68008 WP_001107167.1.68011 WP_001107167.1.68012 WP_001107167.1.6802 WP_001107167.1.68025 WP_001107167.1.68052 WP_001107167.1.68058 WP_001107167.1.68059 WP_001107167.1.68063 WP_001107167.1.68070 WP_001107167.1.68071 WP_001107167.1.68079 WP_001107167.1.68096 WP_001107167.1.6810 WP_001107167.1.68138 WP_001107167.1.6814 WP_001107167.1.68170 WP_001107167.1.682 WP_001107167.1.68215 WP_001107167.1.68231 WP_001107167.1.68241 WP_001107167.1.68255 WP_001107167.1.68279 WP_001107167.1.68283 WP_001107167.1.68292 WP_001107167.1.68300 WP_001107167.1.68336 WP_001107167.1.68347 WP_001107167.1.68372 WP_001107167.1.68396 WP_001107167.1.68411 WP_001107167.1.68441 WP_001107167.1.68442 WP_001107167.1.68493 WP_001107167.1.68523 WP_001107167.1.68534 WP_001107167.1.68566 WP_001107167.1.6859 WP_001107167.1.6860 WP_001107167.1.68609 WP_001107167.1.68673 WP_001107167.1.68678 WP_001107167.1.68695 WP_001107167.1.68697 WP_001107167.1.68711 WP_001107167.1.68735 WP_001107167.1.68751 WP_001107167.1.6877 WP_001107167.1.68797 WP_001107167.1.6880 WP_001107167.1.68838 WP_001107167.1.68865 WP_001107167.1.6887 WP_001107167.1.68877 WP_001107167.1.68911 WP_001107167.1.68915 WP_001107167.1.68936 WP_001107167.1.68942 WP_001107167.1.68989 WP_001107167.1.69054 WP_001107167.1.69126 WP_001107167.1.69127 WP_001107167.1.69144 WP_001107167.1.69160 WP_001107167.1.6921 WP_001107167.1.6923 WP_001107167.1.69247 WP_001107167.1.69258 WP_001107167.1.69261 WP_001107167.1.69303 WP_001107167.1.69305 WP_001107167.1.69327 WP_001107167.1.69341 WP_001107167.1.69350 WP_001107167.1.69351 WP_001107167.1.69382 WP_001107167.1.694 WP_001107167.1.69438 WP_001107167.1.6945 WP_001107167.1.69450 WP_001107167.1.69472 WP_001107167.1.69473 WP_001107167.1.69502 WP_001107167.1.69551 WP_001107167.1.69569 WP_001107167.1.69583 WP_001107167.1.69593 WP_001107167.1.69646 WP_001107167.1.69655 WP_001107167.1.69689 WP_001107167.1.697 WP_001107167.1.69780 WP_001107167.1.69803 WP_001107167.1.69810 WP_001107167.1.69818 WP_001107167.1.69832 WP_001107167.1.69872 WP_001107167.1.69887 WP_001107167.1.69896 WP_001107167.1.69963 WP_001107167.1.69972 WP_001107167.1.69999 WP_001107167.1.70063 WP_001107167.1.701 WP_001107167.1.70123 WP_001107167.1.70125 WP_001107167.1.70149 WP_001107167.1.7015 WP_001107167.1.70200 WP_001107167.1.70213 WP_001107167.1.70230 WP_001107167.1.70300 WP_001107167.1.70357 WP_001107167.1.70370 WP_001107167.1.70386 WP_001107167.1.70408 WP_001107167.1.70414 WP_001107167.1.70477 WP_001107167.1.70492 WP_001107167.1.70517 WP_001107167.1.7052 WP_001107167.1.70539 WP_001107167.1.70563 WP_001107167.1.70576 WP_001107167.1.70578 WP_001107167.1.70582 WP_001107167.1.70619 WP_001107167.1.70628 WP_001107167.1.70655 WP_001107167.1.70694 WP_001107167.1.70705 WP_001107167.1.70713 WP_001107167.1.70723 WP_001107167.1.70745 WP_001107167.1.70767 WP_001107167.1.70787 WP_001107167.1.70794 WP_001107167.1.70801 WP_001107167.1.70880 WP_001107167.1.7090 WP_001107167.1.70900 WP_001107167.1.71003 WP_001107167.1.7102 WP_001107167.1.71024 WP_001107167.1.71042 WP_001107167.1.71099 WP_001107167.1.71113 WP_001107167.1.71134 WP_001107167.1.71159 WP_001107167.1.71162 WP_001107167.1.71183 WP_001107167.1.71192 WP_001107167.1.71199 WP_001107167.1.71205 WP_001107167.1.71225 WP_001107167.1.71226 WP_001107167.1.71229 WP_001107167.1.71269 WP_001107167.1.71272 WP_001107167.1.71275 WP_001107167.1.71285 WP_001107167.1.71287 WP_001107167.1.71312 WP_001107167.1.71315 WP_001107167.1.71323 WP_001107167.1.71327 WP_001107167.1.71403 WP_001107167.1.71409 WP_001107167.1.71423 WP_001107167.1.71448 WP_001107167.1.71480 WP_001107167.1.71522 WP_001107167.1.71538 WP_001107167.1.71540 WP_001107167.1.71562 WP_001107167.1.71603 WP_001107167.1.71607 WP_001107167.1.71632 WP_001107167.1.71680 WP_001107167.1.71690 WP_001107167.1.71695 WP_001107167.1.71757 WP_001107167.1.71767 WP_001107167.1.71783 WP_001107167.1.71830 WP_001107167.1.71837 WP_001107167.1.71840 WP_001107167.1.71856 WP_001107167.1.71874 WP_001107167.1.71912 WP_001107167.1.71938 WP_001107167.1.71940 WP_001107167.1.71944 WP_001107167.1.71967 WP_001107167.1.71972 WP_001107167.1.71975 WP_001107167.1.71987 WP_001107167.1.71993 WP_001107167.1.71995 WP_001107167.1.72013 WP_001107167.1.72016 WP_001107167.1.72033 WP_001107167.1.72048 WP_001107167.1.72053 WP_001107167.1.72098 WP_001107167.1.72117 WP_001107167.1.72125 WP_001107167.1.72141 WP_001107167.1.72153 WP_001107167.1.72157 WP_001107167.1.72162 WP_001107167.1.72180 WP_001107167.1.72184 WP_001107167.1.72186 WP_001107167.1.72208 WP_001107167.1.72237 WP_001107167.1.72258 WP_001107167.1.72261 WP_001107167.1.72270 WP_001107167.1.72279 WP_001107167.1.72298 WP_001107167.1.723 WP_001107167.1.72316 WP_001107167.1.72322 WP_001107167.1.72337 WP_001107167.1.72352 WP_001107167.1.72397 WP_001107167.1.72425 WP_001107167.1.72427 WP_001107167.1.72431 WP_001107167.1.72436 WP_001107167.1.72485 WP_001107167.1.72493 WP_001107167.1.72507 WP_001107167.1.72511 WP_001107167.1.72521 WP_001107167.1.72535 WP_001107167.1.72537 WP_001107167.1.72544 WP_001107167.1.72551 WP_001107167.1.72588 WP_001107167.1.72596 WP_001107167.1.72599 WP_001107167.1.72606 WP_001107167.1.72608 WP_001107167.1.72614 WP_001107167.1.72616 WP_001107167.1.72619 WP_001107167.1.72641 WP_001107167.1.72643 WP_001107167.1.72652 WP_001107167.1.72663 WP_001107167.1.72694 WP_001107167.1.72695 WP_001107167.1.72706 WP_001107167.1.72745 WP_001107167.1.72747 WP_001107167.1.72758 WP_001107167.1.7277 WP_001107167.1.72837 WP_001107167.1.72857 WP_001107167.1.72858 WP_001107167.1.72860 WP_001107167.1.72869 WP_001107167.1.72893 WP_001107167.1.7291 WP_001107167.1.72910 WP_001107167.1.72913 WP_001107167.1.72947 WP_001107167.1.72950 WP_001107167.1.72962 WP_001107167.1.73010 WP_001107167.1.73032 WP_001107167.1.73039 WP_001107167.1.73061 WP_001107167.1.73075 WP_001107167.1.73085 WP_001107167.1.7309 WP_001107167.1.73094 WP_001107167.1.73126 WP_001107167.1.73129 WP_001107167.1.73197 WP_001107167.1.73217 WP_001107167.1.73230 WP_001107167.1.73239 WP_001107167.1.73249 WP_001107167.1.73277 WP_001107167.1.73292 WP_001107167.1.73295 WP_001107167.1.73326 WP_001107167.1.73340 WP_001107167.1.73343 WP_001107167.1.73385 WP_001107167.1.73428 WP_001107167.1.73468 WP_001107167.1.7349 WP_001107167.1.73524 WP_001107167.1.73565 WP_001107167.1.73572 WP_001107167.1.73604 WP_001107167.1.73626 WP_001107167.1.73663 WP_001107167.1.73700 WP_001107167.1.73709 WP_001107167.1.73717 WP_001107167.1.73748 WP_001107167.1.7376 WP_001107167.1.73783 WP_001107167.1.73785 WP_001107167.1.73797 WP_001107167.1.73801 WP_001107167.1.73827 WP_001107167.1.73835 WP_001107167.1.73843 WP_001107167.1.73844 WP_001107167.1.73859 WP_001107167.1.73882 WP_001107167.1.7392 WP_001107167.1.73934 WP_001107167.1.73942 WP_001107167.1.73968 WP_001107167.1.73992 WP_001107167.1.73995 WP_001107167.1.74032 WP_001107167.1.74041 WP_001107167.1.7407 WP_001107167.1.7411 WP_001107167.1.74123 WP_001107167.1.74184 WP_001107167.1.74185 WP_001107167.1.7424 WP_001107167.1.7425 WP_001107167.1.74251 WP_001107167.1.74267 WP_001107167.1.7429 WP_001107167.1.74309 WP_001107167.1.74358 WP_001107167.1.74367 WP_001107167.1.744 WP_001107167.1.74423 WP_001107167.1.74426 WP_001107167.1.74431 WP_001107167.1.74444 WP_001107167.1.74445 WP_001107167.1.7446 WP_001107167.1.74478 WP_001107167.1.74491 WP_001107167.1.74520 WP_001107167.1.74521 WP_001107167.1.74528 WP_001107167.1.74536 WP_001107167.1.74549 WP_001107167.1.74557 WP_001107167.1.74574 WP_001107167.1.7461 WP_001107167.1.74611 WP_001107167.1.74623 WP_001107167.1.74624 WP_001107167.1.74625 WP_001107167.1.74631 WP_001107167.1.74652 WP_001107167.1.74682 WP_001107167.1.74688 WP_001107167.1.74705 WP_001107167.1.74713 WP_001107167.1.74720 WP_001107167.1.7475 WP_001107167.1.74752 WP_001107167.1.74767 WP_001107167.1.7478 WP_001107167.1.74828 WP_001107167.1.74854 WP_001107167.1.74860 WP_001107167.1.74880 WP_001107167.1.74885 WP_001107167.1.74895 WP_001107167.1.74904 WP_001107167.1.74915 WP_001107167.1.74962 WP_001107167.1.74998 WP_001107167.1.75030 WP_001107167.1.75050 WP_001107167.1.75087 WP_001107167.1.75112 WP_001107167.1.75139 WP_001107167.1.75145 WP_001107167.1.75149 WP_001107167.1.7516 WP_001107167.1.75181 WP_001107167.1.75209 WP_001107167.1.75248 WP_001107167.1.75254 WP_001107167.1.75272 WP_001107167.1.7536 WP_001107167.1.75360 WP_001107167.1.75367 WP_001107167.1.75382 WP_001107167.1.7539 WP_001107167.1.75428 WP_001107167.1.75435 WP_001107167.1.75491 WP_001107167.1.75507 WP_001107167.1.75529 WP_001107167.1.75536 WP_001107167.1.75537 WP_001107167.1.75577 WP_001107167.1.75588 WP_001107167.1.75594 WP_001107167.1.75612 WP_001107167.1.75629 WP_001107167.1.75644 WP_001107167.1.75653 WP_001107167.1.75672 WP_001107167.1.75676 WP_001107167.1.75679 WP_001107167.1.75687 WP_001107167.1.75694 WP_001107167.1.75696 WP_001107167.1.75699 WP_001107167.1.75735 WP_001107167.1.75758 WP_001107167.1.75767 WP_001107167.1.7583 WP_001107167.1.75839 WP_001107167.1.75892 WP_001107167.1.75922 WP_001107167.1.7597 WP_001107167.1.75973 WP_001107167.1.75983 WP_001107167.1.75989 WP_001107167.1.75995 WP_001107167.1.75999 WP_001107167.1.76009 WP_001107167.1.76019 WP_001107167.1.7603 WP_001107167.1.76036 WP_001107167.1.76054 WP_001107167.1.76057 WP_001107167.1.7608 WP_001107167.1.76103 WP_001107167.1.76129 WP_001107167.1.76152 WP_001107167.1.7617 WP_001107167.1.76184 WP_001107167.1.76189 WP_001107167.1.76194 WP_001107167.1.76211 WP_001107167.1.76237 WP_001107167.1.76268 WP_001107167.1.76269 WP_001107167.1.76305 WP_001107167.1.76335 WP_001107167.1.76361 WP_001107167.1.76376 WP_001107167.1.76384 WP_001107167.1.76387 WP_001107167.1.76407 WP_001107167.1.76448 WP_001107167.1.76462 WP_001107167.1.76477 WP_001107167.1.76504 WP_001107167.1.76542 WP_001107167.1.76547 WP_001107167.1.76562 WP_001107167.1.76595 WP_001107167.1.76596 WP_001107167.1.7661 WP_001107167.1.76619 WP_001107167.1.76660 WP_001107167.1.76697 WP_001107167.1.76707 WP_001107167.1.76712 WP_001107167.1.76759 WP_001107167.1.7680 WP_001107167.1.76815 WP_001107167.1.76827 WP_001107167.1.76840 WP_001107167.1.76909 WP_001107167.1.76918 WP_001107167.1.76933 WP_001107167.1.76948 WP_001107167.1.76961 WP_001107167.1.76965 WP_001107167.1.76966 WP_001107167.1.7699 WP_001107167.1.76994 WP_001107167.1.77007 WP_001107167.1.77015 WP_001107167.1.77022 WP_001107167.1.77036 WP_001107167.1.77042 WP_001107167.1.77057 WP_001107167.1.77070 WP_001107167.1.77081 WP_001107167.1.77099 WP_001107167.1.77109 WP_001107167.1.77128 WP_001107167.1.77134 WP_001107167.1.77147 WP_001107167.1.77173 WP_001107167.1.77175 WP_001107167.1.77239 WP_001107167.1.77253 WP_001107167.1.77258 WP_001107167.1.77275 WP_001107167.1.7728 WP_001107167.1.77284 WP_001107167.1.7729 WP_001107167.1.77290 WP_001107167.1.77291 WP_001107167.1.77320 WP_001107167.1.77326 WP_001107167.1.77341 WP_001107167.1.77358 WP_001107167.1.77392 WP_001107167.1.77408 WP_001107167.1.77419 WP_001107167.1.77432 WP_001107167.1.77452 WP_001107167.1.7747 WP_001107167.1.77481 WP_001107167.1.77487 WP_001107167.1.77495 WP_001107167.1.7750 WP_001107167.1.77503 WP_001107167.1.77511 WP_001107167.1.77551 WP_001107167.1.7756 WP_001107167.1.77595 WP_001107167.1.77608 WP_001107167.1.77643 WP_001107167.1.77644 WP_001107167.1.77648 WP_001107167.1.77707 WP_001107167.1.77760 WP_001107167.1.77768 WP_001107167.1.77816 WP_001107167.1.77833 WP_001107167.1.77950 WP_001107167.1.77961 WP_001107167.1.77979 WP_001107167.1.7799 WP_001107167.1.78000 WP_001107167.1.78007 WP_001107167.1.7804 WP_001107167.1.78063 WP_001107167.1.7808 WP_001107167.1.78101 WP_001107167.1.78102 WP_001107167.1.78131 WP_001107167.1.78183 WP_001107167.1.78187 WP_001107167.1.78188 WP_001107167.1.78202 WP_001107167.1.78232 WP_001107167.1.78233 WP_001107167.1.78235 WP_001107167.1.78321 WP_001107167.1.784 WP_001107167.1.78413 WP_001107167.1.78453 WP_001107167.1.78462 WP_001107167.1.78463 WP_001107167.1.7847 WP_001107167.1.78481 WP_001107167.1.78512 WP_001107167.1.7855 WP_001107167.1.78581 WP_001107167.1.78583 WP_001107167.1.78586 WP_001107167.1.78593 WP_001107167.1.78610 WP_001107167.1.78611 WP_001107167.1.78612 WP_001107167.1.78615 WP_001107167.1.78622 WP_001107167.1.78645 WP_001107167.1.78677 WP_001107167.1.78683 WP_001107167.1.78689 WP_001107167.1.78698 WP_001107167.1.78706 WP_001107167.1.78714 WP_001107167.1.78718 WP_001107167.1.78750 WP_001107167.1.78757 WP_001107167.1.78773 WP_001107167.1.78775 WP_001107167.1.78791 WP_001107167.1.78843 WP_001107167.1.78854 WP_001107167.1.78895 WP_001107167.1.78919 WP_001107167.1.7896 WP_001107167.1.78966 WP_001107167.1.79001 WP_001107167.1.79004 WP_001107167.1.79086 WP_001107167.1.79100 WP_001107167.1.79172 WP_001107167.1.79246 WP_001107167.1.79306 WP_001107167.1.79312 WP_001107167.1.79342 WP_001107167.1.79343 WP_001107167.1.79346 WP_001107167.1.79356 WP_001107167.1.79365 WP_001107167.1.79368 WP_001107167.1.79369 WP_001107167.1.79389 WP_001107167.1.7940 WP_001107167.1.79409 WP_001107167.1.79414 WP_001107167.1.79478 WP_001107167.1.79505 WP_001107167.1.7952 WP_001107167.1.79528 WP_001107167.1.79540 WP_001107167.1.79558 WP_001107167.1.79563 WP_001107167.1.79576 WP_001107167.1.79606 WP_001107167.1.79640 WP_001107167.1.79685 WP_001107167.1.79707 WP_001107167.1.79715 WP_001107167.1.79764 WP_001107167.1.79800 WP_001107167.1.79816 WP_001107167.1.79824 WP_001107167.1.7985 WP_001107167.1.79866 WP_001107167.1.7987 WP_001107167.1.79871 WP_001107167.1.79905 WP_001107167.1.7993 WP_001107167.1.79930 WP_001107167.1.79931 WP_001107167.1.79936 WP_001107167.1.79955 WP_001107167.1.79965 WP_001107167.1.79984 WP_001107167.1.79995 WP_001107167.1.80043 WP_001107167.1.80050 WP_001107167.1.80060 WP_001107167.1.80063 WP_001107167.1.80071 WP_001107167.1.8011 WP_001107167.1.80136 WP_001107167.1.80141 WP_001107167.1.80168 WP_001107167.1.80176 WP_001107167.1.80179 WP_001107167.1.80183 WP_001107167.1.80309 WP_001107167.1.80310 WP_001107167.1.80320 WP_001107167.1.80330 WP_001107167.1.804 WP_001107167.1.80402 WP_001107167.1.80426 WP_001107167.1.80428 WP_001107167.1.80440 WP_001107167.1.80444 WP_001107167.1.80484 WP_001107167.1.80517 WP_001107167.1.80519 WP_001107167.1.80524 WP_001107167.1.80558 WP_001107167.1.80559 WP_001107167.1.8057 WP_001107167.1.80577 WP_001107167.1.80578 WP_001107167.1.80606 WP_001107167.1.80612 WP_001107167.1.80626 WP_001107167.1.80660 WP_001107167.1.80662 WP_001107167.1.80666 WP_001107167.1.8068 WP_001107167.1.80709 WP_001107167.1.80753 WP_001107167.1.80754 WP_001107167.1.80756 WP_001107167.1.80768 WP_001107167.1.80789 WP_001107167.1.80805 WP_001107167.1.80884 WP_001107167.1.80894 WP_001107167.1.80935 WP_001107167.1.80945 WP_001107167.1.80946 WP_001107167.1.80948 WP_001107167.1.80983 WP_001107167.1.810 WP_001107167.1.81034 WP_001107167.1.81054 WP_001107167.1.81070 WP_001107167.1.81098 WP_001107167.1.811 WP_001107167.1.81104 WP_001107167.1.81127 WP_001107167.1.81156 WP_001107167.1.81160 WP_001107167.1.81182 WP_001107167.1.81186 WP_001107167.1.8121 WP_001107167.1.81219 WP_001107167.1.81266 WP_001107167.1.81267 WP_001107167.1.81273 WP_001107167.1.81283 WP_001107167.1.81286 WP_001107167.1.8129 WP_001107167.1.81313 WP_001107167.1.81323 WP_001107167.1.81347 WP_001107167.1.81376 WP_001107167.1.81391 WP_001107167.1.81396 WP_001107167.1.814 WP_001107167.1.81418 WP_001107167.1.81420 WP_001107167.1.81442 WP_001107167.1.81484 WP_001107167.1.81514 WP_001107167.1.81517 WP_001107167.1.81577 WP_001107167.1.81589 WP_001107167.1.81618 WP_001107167.1.81625 WP_001107167.1.81715 WP_001107167.1.8172 WP_001107167.1.81754 WP_001107167.1.81761 WP_001107167.1.81806 WP_001107167.1.81821 WP_001107167.1.8183 WP_001107167.1.81832 WP_001107167.1.81873 WP_001107167.1.81888 WP_001107167.1.81934 WP_001107167.1.81935 WP_001107167.1.81972 WP_001107167.1.81975 WP_001107167.1.82 WP_001107167.1.82008 WP_001107167.1.82010 WP_001107167.1.82057 WP_001107167.1.82062 WP_001107167.1.82074 WP_001107167.1.82104 WP_001107167.1.82137 WP_001107167.1.82166 WP_001107167.1.82221 WP_001107167.1.82239 WP_001107167.1.82240 WP_001107167.1.82242 WP_001107167.1.82275 WP_001107167.1.82296 WP_001107167.1.8235 WP_001107167.1.82378 WP_001107167.1.82439 WP_001107167.1.82485 WP_001107167.1.82527 WP_001107167.1.82536 WP_001107167.1.82572 WP_001107167.1.82589 WP_001107167.1.82594 WP_001107167.1.82626 WP_001107167.1.82629 WP_001107167.1.82647 WP_001107167.1.8268 WP_001107167.1.82700 WP_001107167.1.82715 WP_001107167.1.82718 WP_001107167.1.82754 WP_001107167.1.8277 WP_001107167.1.82797 WP_001107167.1.82820 WP_001107167.1.82831 WP_001107167.1.82833 WP_001107167.1.82853 WP_001107167.1.82901 WP_001107167.1.82923 WP_001107167.1.8295 WP_001107167.1.82991 WP_001107167.1.83020 WP_001107167.1.83035 WP_001107167.1.8308 WP_001107167.1.83093 WP_001107167.1.83097 WP_001107167.1.83099 WP_001107167.1.831 WP_001107167.1.83125 WP_001107167.1.83140 WP_001107167.1.83144 WP_001107167.1.83151 WP_001107167.1.83205 WP_001107167.1.83218 WP_001107167.1.83224 WP_001107167.1.83238 WP_001107167.1.83256 WP_001107167.1.83313 WP_001107167.1.83347 WP_001107167.1.83393 WP_001107167.1.83415 WP_001107167.1.8345 WP_001107167.1.83537 WP_001107167.1.83544 WP_001107167.1.83582 WP_001107167.1.83584 WP_001107167.1.83644 WP_001107167.1.83668 WP_001107167.1.8368 WP_001107167.1.83706 WP_001107167.1.83712 WP_001107167.1.83735 WP_001107167.1.83781 WP_001107167.1.83820 WP_001107167.1.8384 WP_001107167.1.83936 WP_001107167.1.83941 WP_001107167.1.83947 WP_001107167.1.84014 WP_001107167.1.8405 WP_001107167.1.8408 WP_001107167.1.8411 WP_001107167.1.84140 WP_001107167.1.84172 WP_001107167.1.84185 WP_001107167.1.84197 WP_001107167.1.84210 WP_001107167.1.84219 WP_001107167.1.84221 WP_001107167.1.84264 WP_001107167.1.84298 WP_001107167.1.84312 WP_001107167.1.84313 WP_001107167.1.84326 WP_001107167.1.84331 WP_001107167.1.84339 WP_001107167.1.84405 WP_001107167.1.84410 WP_001107167.1.84436 WP_001107167.1.84467 WP_001107167.1.84473 WP_001107167.1.84482 WP_001107167.1.84486 WP_001107167.1.84584 WP_001107167.1.84635 WP_001107167.1.84656 WP_001107167.1.84657 WP_001107167.1.84668 WP_001107167.1.84697 WP_001107167.1.84738 WP_001107167.1.84740 WP_001107167.1.8477 WP_001107167.1.84784 WP_001107167.1.84797 WP_001107167.1.84850 WP_001107167.1.84875 WP_001107167.1.84877 WP_001107167.1.84881 WP_001107167.1.84893 WP_001107167.1.84929 WP_001107167.1.84941 WP_001107167.1.84948 WP_001107167.1.84966 WP_001107167.1.84972 WP_001107167.1.84977 WP_001107167.1.84989 WP_001107167.1.84994 WP_001107167.1.85002 WP_001107167.1.85025 WP_001107167.1.85048 WP_001107167.1.85052 WP_001107167.1.85077 WP_001107167.1.85090 WP_001107167.1.85098 WP_001107167.1.85112 WP_001107167.1.85125 WP_001107167.1.8517 WP_001107167.1.85247 WP_001107167.1.85252 WP_001107167.1.85253 WP_001107167.1.85255 WP_001107167.1.8530 WP_001107167.1.85320 WP_001107167.1.85323 WP_001107167.1.85335 WP_001107167.1.85336 WP_001107167.1.85342 WP_001107167.1.85384 WP_001107167.1.85435 WP_001107167.1.85500 WP_001107167.1.85525 WP_001107167.1.85554 WP_001107167.1.85556 WP_001107167.1.85558 WP_001107167.1.85578 WP_001107167.1.85593 WP_001107167.1.8560 WP_001107167.1.85621 WP_001107167.1.85722 WP_001107167.1.85752 WP_001107167.1.85762 WP_001107167.1.85772 WP_001107167.1.85773 WP_001107167.1.85781 WP_001107167.1.8579 WP_001107167.1.8592 WP_001107167.1.85939 WP_001107167.1.85944 WP_001107167.1.85948 WP_001107167.1.86001 WP_001107167.1.86016 WP_001107167.1.8603 WP_001107167.1.8607 WP_001107167.1.86105 WP_001107167.1.86115 WP_001107167.1.86161 WP_001107167.1.86171 WP_001107167.1.86181 WP_001107167.1.86189 WP_001107167.1.8621 WP_001107167.1.86225 WP_001107167.1.86227 WP_001107167.1.86228 WP_001107167.1.86234 WP_001107167.1.86255 WP_001107167.1.86261 WP_001107167.1.86263 WP_001107167.1.86273 WP_001107167.1.86276 WP_001107167.1.86294 WP_001107167.1.86307 WP_001107167.1.86340 WP_001107167.1.86353 WP_001107167.1.86412 WP_001107167.1.86451 WP_001107167.1.86452 WP_001107167.1.86454 WP_001107167.1.86461 WP_001107167.1.86475 WP_001107167.1.86492 WP_001107167.1.8652 WP_001107167.1.8656 WP_001107167.1.86560 WP_001107167.1.86574 WP_001107167.1.86586 WP_001107167.1.86609 WP_001107167.1.86613 WP_001107167.1.86627 WP_001107167.1.86674 WP_001107167.1.86681 WP_001107167.1.86691 WP_001107167.1.86731 WP_001107167.1.86753 WP_001107167.1.86760 WP_001107167.1.86787 WP_001107167.1.8679 WP_001107167.1.86833 WP_001107167.1.86848 WP_001107167.1.8687 WP_001107167.1.86959 WP_001107167.1.86994 WP_001107167.1.86997 WP_001107167.1.8705 WP_001107167.1.87067 WP_001107167.1.87075 WP_001107167.1.87076 WP_001107167.1.87102 WP_001107167.1.87109 WP_001107167.1.87147 WP_001107167.1.87199 WP_001107167.1.87205 WP_001107167.1.87247 WP_001107167.1.87254 WP_001107167.1.87310 WP_001107167.1.87382 WP_001107167.1.87389 WP_001107167.1.87443 WP_001107167.1.87491 WP_001107167.1.87504 WP_001107167.1.87557 WP_001107167.1.87563 WP_001107167.1.87574 WP_001107167.1.87590 WP_001107167.1.87610 WP_001107167.1.87616 WP_001107167.1.87635 WP_001107167.1.87639 WP_001107167.1.87655 WP_001107167.1.87675 WP_001107167.1.87694 WP_001107167.1.87696 WP_001107167.1.87721 WP_001107167.1.87726 WP_001107167.1.87738 WP_001107167.1.87766 WP_001107167.1.87834 WP_001107167.1.87857 WP_001107167.1.87914 WP_001107167.1.87919 WP_001107167.1.87989 WP_001107167.1.88020 WP_001107167.1.88082 WP_001107167.1.88110 WP_001107167.1.88197 WP_001107167.1.88234 WP_001107167.1.88252 WP_001107167.1.88260 WP_001107167.1.88263 WP_001107167.1.88301 WP_001107167.1.88304 WP_001107167.1.88384 WP_001107167.1.88427 WP_001107167.1.8843 WP_001107167.1.88434 WP_001107167.1.88462 WP_001107167.1.88467 WP_001107167.1.8848 WP_001107167.1.88524 WP_001107167.1.88528 WP_001107167.1.88535 WP_001107167.1.88539 WP_001107167.1.88562 WP_001107167.1.88598 WP_001107167.1.88603 WP_001107167.1.88607 WP_001107167.1.88631 WP_001107167.1.88646 WP_001107167.1.88667 WP_001107167.1.88709 WP_001107167.1.88710 WP_001107167.1.88711 WP_001107167.1.88717 WP_001107167.1.88729 WP_001107167.1.8873 WP_001107167.1.88732 WP_001107167.1.88757 WP_001107167.1.88759 WP_001107167.1.88767 WP_001107167.1.8879 WP_001107167.1.88793 WP_001107167.1.88803 WP_001107167.1.88826 WP_001107167.1.88834 WP_001107167.1.88880 WP_001107167.1.88883 WP_001107167.1.88891 WP_001107167.1.88941 WP_001107167.1.88950 WP_001107167.1.88961 WP_001107167.1.88997 WP_001107167.1.89043 WP_001107167.1.89050 WP_001107167.1.89067 WP_001107167.1.89069 WP_001107167.1.89090 WP_001107167.1.89099 WP_001107167.1.89150 WP_001107167.1.89183 WP_001107167.1.89197 WP_001107167.1.89200 WP_001107167.1.89217 WP_001107167.1.89285 WP_001107167.1.89305 WP_001107167.1.89312 WP_001107167.1.89322 WP_001107167.1.89334 WP_001107167.1.89335 WP_001107167.1.89351 WP_001107167.1.89379 WP_001107167.1.8938 WP_001107167.1.89385 WP_001107167.1.89396 WP_001107167.1.89416 WP_001107167.1.89427 WP_001107167.1.89458 WP_001107167.1.89469 WP_001107167.1.89474 WP_001107167.1.89479 WP_001107167.1.89551 WP_001107167.1.89569 WP_001107167.1.89601 WP_001107167.1.89631 WP_001107167.1.89646 WP_001107167.1.89679 WP_001107167.1.89700 WP_001107167.1.89747 WP_001107167.1.89768 WP_001107167.1.89781 WP_001107167.1.89788 WP_001107167.1.89818 WP_001107167.1.89839 WP_001107167.1.89852 WP_001107167.1.89899 WP_001107167.1.89915 WP_001107167.1.89920 WP_001107167.1.89923 WP_001107167.1.89927 WP_001107167.1.89959 WP_001107167.1.89977 WP_001107167.1.89988 WP_001107167.1.90017 WP_001107167.1.90078 WP_001107167.1.9010 WP_001107167.1.90128 WP_001107167.1.90139 WP_001107167.1.90146 WP_001107167.1.90156 WP_001107167.1.90168 WP_001107167.1.90171 WP_001107167.1.902 WP_001107167.1.90205 WP_001107167.1.90219 WP_001107167.1.90256 WP_001107167.1.90270 WP_001107167.1.90342 WP_001107167.1.90349 WP_001107167.1.90357 WP_001107167.1.90358 WP_001107167.1.9037 WP_001107167.1.90389 WP_001107167.1.90405 WP_001107167.1.90435 WP_001107167.1.90449 WP_001107167.1.90511 WP_001107167.1.90520 WP_001107167.1.90525 WP_001107167.1.90542 WP_001107167.1.90547 WP_001107167.1.90591 WP_001107167.1.90602 WP_001107167.1.9061 WP_001107167.1.90690 WP_001107167.1.90703 WP_001107167.1.90706 WP_001107167.1.90775 WP_001107167.1.90799 WP_001107167.1.9081 WP_001107167.1.90813 WP_001107167.1.90822 WP_001107167.1.90828 WP_001107167.1.90837 WP_001107167.1.90839 WP_001107167.1.90848 WP_001107167.1.90856 WP_001107167.1.90865 WP_001107167.1.9087 WP_001107167.1.90905 WP_001107167.1.90924 WP_001107167.1.90951 WP_001107167.1.90967 WP_001107167.1.90979 WP_001107167.1.9098 WP_001107167.1.90996 WP_001107167.1.90997 WP_001107167.1.91010 WP_001107167.1.91018 WP_001107167.1.91072 WP_001107167.1.91088 WP_001107167.1.91094 WP_001107167.1.91121 WP_001107167.1.91153 WP_001107167.1.91170 WP_001107167.1.9119 WP_001107167.1.91213 WP_001107167.1.91220 WP_001107167.1.91266 WP_001107167.1.91288 WP_001107167.1.91340 WP_001107167.1.91356 WP_001107167.1.91384 WP_001107167.1.91445 WP_001107167.1.91462 WP_001107167.1.91482 WP_001107167.1.91485 WP_001107167.1.915 WP_001107167.1.91515 WP_001107167.1.91548 WP_001107167.1.91551 WP_001107167.1.91566 WP_001107167.1.9160 WP_001107167.1.91626 WP_001107167.1.91640 WP_001107167.1.91644 WP_001107167.1.91651 WP_001107167.1.91666 WP_001107167.1.91672 WP_001107167.1.9168 WP_001107167.1.91739 WP_001107167.1.91756 WP_001107167.1.91777 WP_001107167.1.91801 WP_001107167.1.91814 WP_001107167.1.91843 WP_001107167.1.91850 WP_001107167.1.91871 WP_001107167.1.91879 WP_001107167.1.91887 WP_001107167.1.91965 WP_001107167.1.91971 WP_001107167.1.9199 WP_001107167.1.92005 WP_001107167.1.92014 WP_001107167.1.92019 WP_001107167.1.92025 WP_001107167.1.92031 WP_001107167.1.92053 WP_001107167.1.92058 WP_001107167.1.9209 WP_001107167.1.92096 WP_001107167.1.921 WP_001107167.1.92102 WP_001107167.1.92114 WP_001107167.1.9215 WP_001107167.1.92163 WP_001107167.1.92180 WP_001107167.1.92201 WP_001107167.1.92276 WP_001107167.1.92304 WP_001107167.1.92305 WP_001107167.1.92311 WP_001107167.1.92323 WP_001107167.1.92361 WP_001107167.1.92403 WP_001107167.1.92434 WP_001107167.1.92473 WP_001107167.1.92532 WP_001107167.1.9255 WP_001107167.1.92577 WP_001107167.1.92615 WP_001107167.1.92638 WP_001107167.1.9264 WP_001107167.1.92648 WP_001107167.1.9266 WP_001107167.1.92668 WP_001107167.1.92693 WP_001107167.1.92708 WP_001107167.1.92742 WP_001107167.1.92750 WP_001107167.1.92780 WP_001107167.1.92792 WP_001107167.1.92819 WP_001107167.1.92845 WP_001107167.1.92865 WP_001107167.1.92943 WP_001107167.1.92953 WP_001107167.1.92989 WP_001107167.1.93016 WP_001107167.1.93019 WP_001107167.1.93027 WP_001107167.1.93033 WP_001107167.1.93048 WP_001107167.1.93054 WP_001107167.1.93069 WP_001107167.1.93112 WP_001107167.1.93133 WP_001107167.1.93139 WP_001107167.1.93185 WP_001107167.1.93252 WP_001107167.1.9327 WP_001107167.1.93276 WP_001107167.1.93291 WP_001107167.1.93309 WP_001107167.1.93312 WP_001107167.1.93338 WP_001107167.1.93388 WP_001107167.1.934 WP_001107167.1.93427 WP_001107167.1.93428 WP_001107167.1.93461 WP_001107167.1.93509 WP_001107167.1.93531 WP_001107167.1.93533 WP_001107167.1.93601 WP_001107167.1.93629 WP_001107167.1.93630 WP_001107167.1.93634 WP_001107167.1.93637 WP_001107167.1.93639 WP_001107167.1.93652 WP_001107167.1.93665 WP_001107167.1.93670 WP_001107167.1.93679 WP_001107167.1.93694 WP_001107167.1.93695 WP_001107167.1.93716 WP_001107167.1.93733 WP_001107167.1.93737 WP_001107167.1.93745 WP_001107167.1.93755 WP_001107167.1.93765 WP_001107167.1.93768 WP_001107167.1.93800 WP_001107167.1.93821 WP_001107167.1.93873 WP_001107167.1.93939 WP_001107167.1.93951 WP_001107167.1.93971 WP_001107167.1.94008 WP_001107167.1.94011 WP_001107167.1.94025 WP_001107167.1.94035 WP_001107167.1.94040 WP_001107167.1.94057 WP_001107167.1.94069 WP_001107167.1.9416 WP_001107167.1.94176 WP_001107167.1.94187 WP_001107167.1.9420 WP_001107167.1.94213 WP_001107167.1.9426 WP_001107167.1.94271 WP_001107167.1.94282 WP_001107167.1.94302 WP_001107167.1.94317 WP_001107167.1.94343 WP_001107167.1.94367 WP_001107167.1.94388 WP_001107167.1.94436 WP_001107167.1.94445 WP_001107167.1.94446 WP_001107167.1.94468 WP_001107167.1.94475 WP_001107167.1.94507 WP_001107167.1.94542 WP_001107167.1.94544 WP_001107167.1.94548 WP_001107167.1.9457 WP_001107167.1.94578 WP_001107167.1.94580 WP_001107167.1.94589 WP_001107167.1.94619 WP_001107167.1.94626 WP_001107167.1.94646 WP_001107167.1.94653 WP_001107167.1.94676 WP_001107167.1.94692 WP_001107167.1.94695 WP_001107167.1.94704 WP_001107167.1.94738 WP_001107167.1.94739 WP_001107167.1.9474 WP_001107167.1.94754 WP_001107167.1.94764 WP_001107167.1.94790 WP_001107167.1.948 WP_001107167.1.94836 WP_001107167.1.94869 WP_001107167.1.94880 WP_001107167.1.94889 WP_001107167.1.9489 WP_001107167.1.94898 WP_001107167.1.94927 WP_001107167.1.94934 WP_001107167.1.94935 WP_001107167.1.94938 WP_001107167.1.94949 WP_001107167.1.94991 WP_001107167.1.94993 WP_001107167.1.95005 WP_001107167.1.95011 WP_001107167.1.95022 WP_001107167.1.95028 WP_001107167.1.95035 WP_001107167.1.95037 WP_001107167.1.95080 WP_001107167.1.95084 WP_001107167.1.95129 WP_001107167.1.9513 WP_001107167.1.95244 WP_001107167.1.95275 WP_001107167.1.95310 WP_001107167.1.95368 WP_001107167.1.95390 WP_001107167.1.95395 WP_001107167.1.95398 WP_001107167.1.95424 WP_001107167.1.95438 WP_001107167.1.95449 WP_001107167.1.95490 WP_001107167.1.95518 WP_001107167.1.95521 WP_001107167.1.95563 WP_001107167.1.9559 WP_001107167.1.95595 WP_001107167.1.95604 WP_001107167.1.95611 WP_001107167.1.95628 WP_001107167.1.95634 WP_001107167.1.95655 WP_001107167.1.95771 WP_001107167.1.95800 WP_001107167.1.95827 WP_001107167.1.95834 WP_001107167.1.95846 WP_001107167.1.95849 WP_001107167.1.95858 WP_001107167.1.95861 WP_001107167.1.95869 WP_001107167.1.95919 WP_001107167.1.95931 WP_001107167.1.95932 WP_001107167.1.960 WP_001107167.1.96059 WP_001107167.1.96097 WP_001107167.1.96143 WP_001107167.1.9616 WP_001107167.1.96177 WP_001107167.1.96215 WP_001107167.1.96229 WP_001107167.1.96247 WP_001107167.1.96253 WP_001107167.1.96278 WP_001107167.1.96279 WP_001107167.1.96281 WP_001107167.1.96290 WP_001107167.1.96299 WP_001107167.1.9631 WP_001107167.1.96339 WP_001107167.1.96378 WP_001107167.1.96392 WP_001107167.1.96394 WP_001107167.1.96417 WP_001107167.1.96425 WP_001107167.1.96450 WP_001107167.1.96478 WP_001107167.1.96479 WP_001107167.1.96480 WP_001107167.1.9649 WP_001107167.1.96494 WP_001107167.1.96519 WP_001107167.1.96541 WP_001107167.1.96558 WP_001107167.1.96562 WP_001107167.1.9657 WP_001107167.1.96609 WP_001107167.1.96617 WP_001107167.1.96650 WP_001107167.1.96676 WP_001107167.1.9668 WP_001107167.1.96725 WP_001107167.1.96759 WP_001107167.1.96762 WP_001107167.1.96796 WP_001107167.1.96797 WP_001107167.1.9682 WP_001107167.1.96907 WP_001107167.1.9691 WP_001107167.1.96924 WP_001107167.1.96936 WP_001107167.1.96971 WP_001107167.1.97011 WP_001107167.1.97027 WP_001107167.1.97059 WP_001107167.1.97119 WP_001107167.1.97123 WP_001107167.1.97170 WP_001107167.1.97193 WP_001107167.1.9723 WP_001107167.1.97238 WP_001107167.1.97247 WP_001107167.1.97269 WP_001107167.1.97282 WP_001107167.1.9729 WP_001107167.1.97292 WP_001107167.1.97344 WP_001107167.1.97351 WP_001107167.1.97356 WP_001107167.1.97360 WP_001107167.1.97361 WP_001107167.1.97379 WP_001107167.1.97387 WP_001107167.1.9740 WP_001107167.1.97402 WP_001107167.1.97418 WP_001107167.1.97421 WP_001107167.1.97434 WP_001107167.1.97439 WP_001107167.1.97464 WP_001107167.1.9747 WP_001107167.1.97490 WP_001107167.1.97513 WP_001107167.1.97525 WP_001107167.1.97538 WP_001107167.1.97544 WP_001107167.1.97549 WP_001107167.1.97560 WP_001107167.1.97571 WP_001107167.1.97632 WP_001107167.1.97654 WP_001107167.1.97667 WP_001107167.1.97677 WP_001107167.1.97685 WP_001107167.1.9770 WP_001107167.1.97778 WP_001107167.1.97789 WP_001107167.1.978 WP_001107167.1.97822 WP_001107167.1.97825 WP_001107167.1.97871 WP_001107167.1.97930 WP_001107167.1.97932 WP_001107167.1.97962 WP_001107167.1.97982 WP_001107167.1.97996 WP_001107167.1.98000 WP_001107167.1.98005 WP_001107167.1.98012 WP_001107167.1.9803 WP_001107167.1.98046 WP_001107167.1.98083 WP_001107167.1.981 WP_001107167.1.98102 WP_001107167.1.98139 WP_001107167.1.98155 WP_001107167.1.9816 WP_001107167.1.9817 WP_001107167.1.98176 WP_001107167.1.98187 WP_001107167.1.98202 WP_001107167.1.98205 WP_001107167.1.98220 WP_001107167.1.98232 WP_001107167.1.98235 WP_001107167.1.98239 WP_001107167.1.98241 WP_001107167.1.98244 WP_001107167.1.98279 WP_001107167.1.98294 WP_001107167.1.98312 WP_001107167.1.98355 WP_001107167.1.98357 WP_001107167.1.98384 WP_001107167.1.98400 WP_001107167.1.98404 WP_001107167.1.98424 WP_001107167.1.98429 WP_001107167.1.9844 WP_001107167.1.98442 WP_001107167.1.98466 WP_001107167.1.98477 WP_001107167.1.98484 WP_001107167.1.98543 WP_001107167.1.98549 WP_001107167.1.98569 WP_001107167.1.98578 WP_001107167.1.9858 WP_001107167.1.98614 WP_001107167.1.98626 WP_001107167.1.98628 WP_001107167.1.98683 WP_001107167.1.98702 WP_001107167.1.98727 WP_001107167.1.98757 WP_001107167.1.98775 WP_001107167.1.98776 WP_001107167.1.98795 WP_001107167.1.9883 WP_001107167.1.98875 WP_001107167.1.98920 WP_001107167.1.98988 WP_001107167.1.99006 WP_001107167.1.99029 WP_001107167.1.99060 WP_001107167.1.99101 WP_001107167.1.99168 WP_001107167.1.99182 WP_001107167.1.99209 WP_001107167.1.99234 WP_001107167.1.99265 WP_001107167.1.99289 WP_001107167.1.99292 WP_001107167.1.99295 WP_001107167.1.9930 WP_001107167.1.99302 WP_001107167.1.99306 WP_001107167.1.99310 WP_001107167.1.99319 WP_001107167.1.99345 WP_001107167.1.99349 WP_001107167.1.9935 WP_001107167.1.99361 WP_001107167.1.99366 WP_001107167.1.99392 WP_001107167.1.99400 WP_001107167.1.99401 WP_001107167.1.99446 WP_001107167.1.99453 WP_001107167.1.99458 WP_001107167.1.99475 WP_001107167.1.99486 WP_001107167.1.99487 WP_001107167.1.9950 WP_001107167.1.99501 WP_001107167.1.99534 WP_001107167.1.99549 WP_001107167.1.99562 WP_001107167.1.99571 WP_001107167.1.99602 WP_001107167.1.99603 WP_001107167.1.99692 WP_001107167.1.99694 WP_001107167.1.99698 WP_001107167.1.99782 WP_001107167.1.99827 WP_001107167.1.99869 WP_001107167.1.99874 WP_001107167.1.99929 WP_001107167.1.99986 YP_002408653.1.10275 YP_006120852.1.29421 gi|254162488|ref|YP_003045596.1| gi|386640045|ref|YP_006106843.1| gi|15803037|ref|NP_289067.1| gi|209398087|ref|YP_002271984.1| gi|544391078|ref|YP_008565658.1| gi|386630284|ref|YP_006150004.1| gi|15832630|ref|NP_311403.1| gi|253772592|ref|YP_003035423.1| gi|16130439|ref|NP_417009.1| gi|378712025|ref|YP_005276918.1| 1kmm_A 1kmm_B 1kmm_C 1kmm_D 1kmn_A 1kmn_B 1kmn_C 1kmn_D my_001000086.1 gi|251785839|ref|YP_003000143.1| gi|222157220|ref|YP_002557359.1| gi|91211840|ref|YP_541826.1| gi|386635204|ref|YP_006154923.1| gi|387622214|ref|YP_006129842.1| gi|386615217|ref|YP_006134883.1| gi|218690634|ref|YP_002398846.1| gi|378712025|ref|YP_005276918.1| gi|218559440|ref|YP_002392353.1| gi|170019203|ref|YP_001724157.1| gi|157155202|ref|YP_001463836.1| gi|387617830|ref|YP_006120852.1| gi|170082124|ref|YP_001731444.1| gi|386625251|ref|YP_006144979.1| gi|110642679|ref|YP_670409.1| gi|291283735|ref|YP_003500553.1| gi|387613110|ref|YP_006116226.1| gi|388478550|ref|YP_490742.1| gi|387883708|ref|YP_006314010.1| gi|386710404|ref|YP_006174125.1| gi|544576991|ref|YP_008572515.1| 1kmmA gi|117624743|ref|YP_853656.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]