SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1kpsB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1kpsB
Domain Number 1 Region: 15-170
Classification Level Classification E-value
Superfamily Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain 8.05e-58
Family Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain 0.0000000537
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1kpsB   PDB: 1kps   SUPERFAMILY: 1kpsB
Sequence length 171
Comment (B:)
Sequence
snsgepapvlssptptdlstflsfpspekllrlgpkvsvlivqqtdtsdpekvvsaflkv
asvfrddasvktavldaidalmkkafscssfnsntfltrllihmgllksedkikaipslh
gplmvlnhvvrqdyfpkalaplllafvtkpngaletcsfarhnllqtlyni
Download sequence
Identical sequences 1kps_B 1kps_D 1kpsB cath|current|1kpsB00/434-589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]