SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1kqpA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1kqpA
Domain Number 1 Region: 3-270
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.54e-126
Family N-type ATP pyrophosphatases 0.0000006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1kqpA   PDB: 1kqp   SUPERFAMILY: 1kqpA
Sequence length 271
Comment (A:)
Sequence
smqekimrelhvkpsidpkqeiedrvnflkqyvkktgakgfvlgisggqdstlagrlaql
avesireeggdaqfiavrlphgtqqdeddaqlalkfikpdkswkfdikstvsafsdqyqq
etgdqltdfnkgnvkartrmiaqyaiggqegllvlgtdhaaeavtgfftkygdggadllp
ltgltkrqgrtllkelgaperlylkeptadlldekpqqsdetelgisydeiddylegkev
sakvsealekrysmtehkrqvpasmfddwwk
Download sequence
Identical sequences 1kqpA 000009836|e1kqpA1|2005.1.1.13|A:1-271 000103325|e1ih8A1|2005.1.1.13|A:1-271 000103326|e1fydB1|2005.1.1.13|B:1-271 000103328|e2nsyA1|2005.1.1.13|A:1-271 000103329|e1ee1B1|2005.1.1.13|B:1-271 000103330|e1ih8B1|2005.1.1.13|B:1-271 000103332|e1kqpB1|2005.1.1.13|B:1-271 000103333|e1ifxB1|2005.1.1.13|B:1-271 000103335|e2nsyB1|2005.1.1.13|B:1-271 000103338|e1nsyB1|2005.1.1.13|B:1-271 000103339|e1ee1A1|2005.1.1.13|A:1-271 000103340|e1nsyA1|2005.1.1.13|A:1-271 000103341|e1ifxA1|2005.1.1.13|A:1-271 000103342|e1fydA1|2005.1.1.13|A:1-271 cath|current|1ee1A00/1-271 cath|current|1ee1B00/1-271 cath|current|1fydA00/1-271 cath|current|1fydB00/1001-1271 cath|current|1ifxA00/1-271 cath|current|1ifxB00/1001-1271 cath|current|1ih8A00/1-271 cath|current|1ih8B00/1001-1271 cath|current|1kqpA00/1-271 cath|current|1kqpB00/1-271 cath|current|1nsyA00/1-271 cath|current|1nsyB00/1-271 cath|current|2nsyA00/1-271 cath|current|2nsyB00/1-271 d1ee1a_ d1ee1b_ d1fyda_ d1fydb_ d1ifxa_ d1ifxb_ d1ih8a_ d1ih8b_ d1kqpa_ d1kqpb_ d1nsya_ d1nsyb_ d2nsya_ d2nsyb_ 1ee1_A 1ee1_B 1fyd_A 1fyd_B 1ifx_A 1ifx_B 1ih8_A 1ih8_B 1kqp_A 1kqp_B 1nsy_A 1nsy_B 2nsy_A 2nsy_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]