SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1krbC from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1krbC
Domain Number 1 Region: 130-431,480-567
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 1.38e-196
Family alpha-subunit of urease, catalytic domain 0.0000000000013
Further Details:      
 
Domain Number 2 Region: 2-177
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 5.13e-63
Family alpha-Subunit of urease 0.000000834
Further Details:      
 
Domain Number 3 Region: 422-477
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.000000427
Family alpha-Subunit of urease 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1krbC   PDB: 1krb
Sequence length 567
Comment (C:)
Sequence
msnisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqm
laadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaatevia
aegkivtaggidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrm
lqaadslpvnigllgkgnvsqpdalreqvaagviglkiaedwgatpaaidcaltvademd
iqvalhsdtlnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnp
tlpytlntidehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssd
sqamgrvgevilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahe
vgsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgal
gsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqt
yevrvdgelitsepadvlpmaqryflf
Download sequence
Identical sequences 1krbC 1krb_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]