SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1kzqA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1kzqA
Domain Number 1 Region: 5-132
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 1.54e-37
Family Major surface antigen p30, SAG1 0.000000181
Further Details:      
 
Domain Number 2 Region: 134-254
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 4.17e-34
Family Major surface antigen p30, SAG1 0.000000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1kzqA   PDB: 1kzq
Sequence length 289
Comment (A:)
Sequence
sdpplvanqvvtcpdkkstaaviltptenhftlkcpktaltepptlayspnrqicpagtt
ssctskavtlsslipeaedswwtgdsasldtagikltvpiekfpvttqtfvvgcikgdda
qscmvtvtvqarassvvnnvarcsygadstlgpvklsaegpttmtlvcgkdgvkvpqdnn
qycsgttltgcneksfkdilpkltenpwqgnassdkgatltikkeafpaesksviigctg
gspekhhctvklefagaagsaksaagtashvsifamvigligsiaacva
Download sequence
Identical sequences 1kzq_A 1kzq_B 1kzqA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]