SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1l0bA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1l0bA
Domain Number 1 Region: 7-114
Classification Level Classification E-value
Superfamily BRCT domain 8.06e-26
Family BRCT domain 0.00000201
Further Details:      
 
Domain Number 2 Region: 117-212
Classification Level Classification E-value
Superfamily BRCT domain 5.59e-21
Family BRCT domain 0.00000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1l0bA   PDB: 1l0b
Sequence length 229
Comment (A:)
Sequence
keraerdismvvsgltpkevmivqkfaekyrlaltdviteetthviiktdaefvcertlk
yflgiaggkwivsyswviksiqerkllsvhefevkgdvvtgsnhqgprrsresqeklfeg
lqiyccepftnmpkdelermlqlcgasvvkelplltrdtgahpivlvqpsawtedndcpd
igqlckgrlvmwdwvldsisvyrcrdldaylvqnitcgrdgsepqdsnd
Download sequence
Identical sequences 1l0bA 1l0b_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]