SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1l5cA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1l5cA
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily Neurophysin II 1.02e-36
Family Neurophysin II 0.0000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1l5cA   PDB: 1l5c   SUPERFAMILY: 1l5cA
Sequence length 92
Comment (A:)
Sequence
avldldvrtclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
cgsggrcaaagiccspdgceedpacdpeaafs
Download sequence
Identical sequences 000989244|e2lbnA1|709.1.1.1|A:1-92 cath|current|1l5cA00/1-92 cath|current|1l5dA00/1-92 cath|current|2lbnA00/1-92 d1l5ca_ d1l5da_ d2lbna_ 1l5cA 1l5c_A 1l5d_A 2lbn_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]