SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1l5pA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1l5pA
Domain Number 1 Region: 4-91
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.47e-17
Family 2Fe-2S ferredoxin-related 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1l5pA   PDB: 1l5p   SUPERFAMILY: 1l5pA
Sequence length 93
Comment (A:)
Sequence
gtitavkggvkkqlkfeddqtlftvlteaglmsaddtcqgnkacgkcickhvsgkvaaae
ddekefledqpanarlacaitlsgendgavfel
Download sequence
Identical sequences 1l5pA 1l5p_A 1l5p_B 1l5p_C 000006107|e1l5pA1|221.1.1.12|A:1-93 000071925|e1l5pB1|221.1.1.12|B:1-93 000071926|e1l5pC1|221.1.1.12|C:1-93 cath|current|1l5pA00/1-93 cath|current|1l5pB00/1-93 cath|current|1l5pC00/1-93 d1l5pa_ d1l5pb_ d1l5pc_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]