SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1l6uA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1l6uA
Domain Number 1 Region: 6-109
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 8.94e-46
Family 2Fe-2S ferredoxin-related 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1l6uA   PDB: 1l6u   SUPERFAMILY: 1l6uA
Sequence length 128
Comment (A:)
Sequence
sssedkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlife
qhifekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvpdavsdaresidm
gmnsskie
Download sequence
Identical sequences L8IZP3
1l6uA 1l6u_A 1l6v_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]