SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1lb2B from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1lb2B
Domain Number 1 Region: 10-69
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 1.68e-35
Family C-terminal domain of RNA polymerase alpha subunit 0.0000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1lb2B   PDB: 1lb2   SUPERFAMILY: 1lb2B
Sequence length 84
Comment (B:)
Sequence
kpefdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikd
vlasrglslgmrlenwppasiade
Download sequence
Identical sequences 1lb2_B 1lb2_E 3n4m_B 3n4m_C 3n97_B 3n97_C 5ciz_B 1lb2B 000394724|e3k4gA1|102.1.1.25|A:3-86 000394726|e3k4gC1|102.1.1.25|C:3-86 000394729|e3k4gF1|102.1.1.25|F:3-86 000394730|e3k4gG1|102.1.1.25|G:3-86 cath|current|1lb2B00/250-321 cath|current|1lb2E00/250-315 cath|current|3n4mB00/249-322 cath|current|3n4mC00/250-322 cath|current|3n97B00/250-324 cath|current|3n97C00/250-323 d3k4ga_ d3k4gc_ d3k4gf_ d3k4gg_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]