SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1le8B from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1le8B
Domain Number 1 Region: 4-72
Classification Level Classification E-value
Superfamily Homeodomain-like 3.17e-16
Family Homeodomain 0.0000747
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1le8B   PDB: 1le8   SUPERFAMILY: 1le8B
Sequence length 83
Comment (B:)
Sequence
tkpyrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvaarrake
ktitiapeladllsgeplakkke
Download sequence
Identical sequences 1le8B 1le8_B cath|current|1le8B00/132-205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]