SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1lfbA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1lfbA
Domain Number 1 Region: 4-96
Classification Level Classification E-value
Superfamily Homeodomain-like 1.27e-27
Family Homeodomain 0.00000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1lfbA   PDB: 1lfb   SUPERFAMILY: 1lfbA
Sequence length 99
Comment (A:)
Sequence
aridptkkgrrnrfkwgpasqqilfqayerqknpskeeretlveecnraeciqrgvspsq
aqglgsnlvtevrvynwfanrrkeeafrhklamdtykln
Download sequence
Identical sequences 1lfbA 1lfb_A cath|current|1lfbA00/13-90

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]