SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1lwyA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1lwyA
Domain Number 1 Region: 133-319
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.33e-48
Family DNA repair glycosylase, 2 C-terminal domains 0.0000000135
Further Details:      
 
Domain Number 2 Region: 10-132
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.32e-38
Family DNA repair glycosylase, N-terminal domain 0.000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1lwyA   PDB: 1lwy
Sequence length 324
Comment (A:)
Sequence
amadigseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqv
wtltqteeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqev
aqkfqgvrllrqdpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfps
lqalagpeveahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcil
pgvgtkvadciclmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnff
rslwgpyagwaqavlfsadlrqsr
Download sequence
Identical sequences 1lwyA 1hu0_A 1lwv_A 1lww_A 1lwy_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]