SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1m2kA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1m2kA
Domain Number 1 Region: 3-239
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.5e-127
Family Sir2 family of transcriptional regulators 0.00000000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1m2kA   PDB: 1m2k   SUPERFAMILY: 1m2kA
Sequence length 249
Comment (A:)
Sequence
mdekllktiaeskylvaltgagvsaesgiptfrgkdglwnryrpeelanpqafakdpekv
wkwyawrmekvfnaqpnkahqafaelerlgvlkclitqnvddlheragsrnvihlhgslr
vvrctscnnsfevesapkipplpkcdkcgsllrpgvvwagemlppdvldramreveradv
iivagtsavvqpaaslplivkqrggaiieinpdetpltpiadyslrgkagevmdelvrhv
rkalslkln
Download sequence
Identical sequences 1m2k_A 1m2kA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]