SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1m7jA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1m7jA
Domain Number 1 Region: 63-308,349-420
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 3.29e-106
Family D-aminoacylase, catalytic domain 0.00000000117
Further Details:      
 
Domain Number 2 Region: 423-479
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 7.29e-24
Family D-aminoacylase 0.00037
Further Details:      
 
Domain Number 3 Region: 9-62
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 6.96e-20
Family D-aminoacylase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1m7jA   PDB: 1m7j
Sequence length 484
Comment (A:)
Sequence
MSQPDATPFDYILSGGTVIDGTNAPGRLADVGVRGDRIAAVGDLSASSARRRIDVAGKVV
SPGFIDSHTHDDNYLLKHRDMTPKISQGVTTVVTGNCGISLAPLAHANPPAPLDLLDEGG
SFRFARFSDYLEALRAAPPAVNAACMVGHSTLRAAVMPDLRREATADEIQAMQALADDAL
ASGAIGISTGAFYPPAAHASTEEIIEVCRPLITHGGVYATHMRDEGEHIVQALEETFRIG
RELDVPVVISHHKVMGKLNFGRSKETLALIEAAMASQDVSLDAYPYVAGSTMLKQDRVLL
AGRTLITWCKPYPELSGRDLEEIAAERGKSKYDVVPELQPAGAIYFMMDEPDVQRILAFG
PTMIGSDGLPHDERPHPRLWGTFPRVLGHYSRDLGLFPLETAVWKMTGLTAAKFGLAERG
QVQPGYYADLVVFDPATVADSATFEHPTERAAGIHSVYVNGAAVWEDQSFTGQHAGRVLN
RAGA
Download sequence
Identical sequences Q9AGH8
1m7jA 1m7j_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]