SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1m9iA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1m9iA
Domain Number 1 Region: 10-324
Classification Level Classification E-value
Superfamily Annexin 1.68e-190
Family Annexin 0.0000000364
Further Details:      
 
Domain Number 2 Region: 356-669
Classification Level Classification E-value
Superfamily Annexin 6.96e-183
Family Annexin 0.00000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1m9iA   PDB: 1m9i
Sequence length 672
Comment (A:)
Sequence
akpaqgakyrgsihdfpgfdpnqdaealytamkgfgsdkeaildiitsrsnrqrqevcqs
ykslygkdliadlkyeltgkferlivglmrppaycdakeikdaisgigtdekclieilas
rtneqmhqlvaaykdayerdleadiigdtsghfqkmlvvllqgtreeddvvsedlvqqdv
qdlyeagelkwgtdeaqfiyilgnrskqhlrlvfdeylkttgkpieasirgelsgdfekl
mlavvkcirstpeyfaerlfkamkglgtrdntlirimvsrseldmldireifrtkyeksl
ysmikndtsgeykktllklsggdddaagqffpeaaqvayqmwelsavarvelkgdvrpan
dfnpdadakalrkamkglgtdedtiidiithrsnvqrqqirqtfkshfgrdlmtdlksei
sgdlarlilglmmppahydakqlkkamegagtdekalieilatrtnaeiraineaykedy
hksledalssdtsghfrrilislatghreeggenldqaredaqvaaeileiadtpsgdkt
sletrfmtilctrsyphlrrvfqefikmtnydvehtikkemsgdvrdafvaivqsvknkp
lffadklyksmkgagtddktltrimvsrseidllnirrefiekydkslhqaiegdtsgdf
lkallalcgged
Download sequence
Identical sequences 1m9i_A 1m9iA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]