SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ma9A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ma9A
Domain Number 1 Region: 9-191
Classification Level Classification E-value
Superfamily Serum albumin-like 2.46e-66
Family Serum albumin-like 0.0000000794
Further Details:      
 
Domain Number 2 Region: 202-380
Classification Level Classification E-value
Superfamily Serum albumin-like 4.61e-56
Family Serum albumin-like 0.0000000884
Further Details:      
 
Domain Number 3 Region: 388-448
Classification Level Classification E-value
Superfamily Serum albumin-like 8.06e-24
Family Serum albumin-like 0.0000715
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ma9A   PDB: 1ma9
Sequence length 458
Comment (A:)
Sequence
lergrdyeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteacca
egadpdcydtrtsalsakscesnspfpvhpgtaecctkeglerklcmaalkhqpqefpty
veptndeiceafrkdpkeyanqfmweystnygqaplsllvsytksylsmvgscctsaspt
vcflkerlqlkhlsllttlsnrvcsqyaaygekksrlsnliklaqkvptadledvlplae
ditnilskccesasedcmakelpehtvklcdnlstknskfedccqektamdvfvctyfmp
aaqlpelpdvelptnkdvcdpgntkvmdkytfelsrrthlpevflskvleptlkslgecc
dvedsttcfnakgpllkkelssfidkgqelcadysentfteykkklaerlkaklpeatpt
elaklvnkrsdfasnccsinspplycdseidaelknil
Download sequence
Identical sequences 1ma9A 1ma9_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]