SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1mijA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1mijA
Domain Number 1 Region: 2-152
Classification Level Classification E-value
Superfamily Homeodomain-like 1.78e-144
Family Homeodomain 0.0000000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1mijA   PDB: 1mij   SUPERFAMILY: 1mijA
Sequence length 152
Comment (A:)
Sequence
sstltpmhlrkaklmffwvrypssavlkmyfpdikfnknntaqlvkwfsnfrefyyiqme
kyarqavtegiktpddlliagdselyrvlnlhynrnnhievpqnfrfvvestlreffrai
qggkdteqswkksiykiisrmddpvpeyfksp
Download sequence
Identical sequences 000045254|e1xpxA1|101.1.1.13|A:5-156 d1mija_ 1mij_A 1mijA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]