SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1mjhA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1mjhA
Domain Number 1 Region: 4-160
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.12e-37
Family Universal stress protein-like 0.0000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1mjhA   PDB: 1mjh   SUPERFAMILY: 1mjhA
Sequence length 162
Comment (A:)
Sequence
MSVMYKKILYPTDFSETAEIALKHVKAFKTLKAEEVILLHVIDEREIKKRDIFSLLLGVA
GLNKSVEEFENELKNKLTEEAKNKMENIKKELEDVGFKVKDIIVVGIPHEEIVKIAEDEG
VDIIIMGSHGKTNLKEILLGSVTENVIKKSNKPVLVVKRKNS
Download sequence
Identical sequences Q57997
243232.MJ0577 BSGCAIR30507 1mjhA gi|15668757|ref|NP_247556.1| 1mjh_A 1mjh_B cath|current|1mjhA00/3-162 cath|current|1mjhB00/1003-1162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]